{ "metadata": { "analysis_id": "PWWP-Discovery-1.0.0", "version": "1.0.0", "scientific_snapshot": "v1.2", "data_as_of": "2026-10-24", "annotation_snapshot_as_of": "2026-10-26", "scope": "Source-indexed publication and deposition chronology, canonical protein features, mapped deposited constructs, validated isoform core retention.", "date_policy": "Publication year, PDB deposition day, and initial release day remain distinct; no historical priority claims.", "counts": { "raw_bibliography_records": 128, "literature_records": 128, "dated_publications": 98, "research_publication_events": 97, "methodological_publication_events": 1, "undated_literature_records": 29, "experimental_entries": 230, "deposition_events": 230, "release_events": 230, "proteins": 39, "sequence_matched_uniprot_sources": 39, "additional_canonical_features": 71, "validated_isoform_domain_rows": 103 }, "limitations": [ "Bibliographic metadata and selected full-text verification have different scopes, shown per source. This is not a systematic literature review.", "The chronology indexes recorded dates; it does not assign discovery priority or infer milestones from citation order.", "The Phenix methods citation is retained as methodological context, excluded from the default research timeline, and available in the full literature index and all-source scope.", "Publication dates have year precision in the frozen bibliography. The year is not presented as 1 January.", "PDB entries can be associated with a protein without observed PWWP coordinates; observed-coordinate status is explicit.", "Current UniProt features are accepted only when the canonical sequence exactly matches the frozen Atlas sequence. Annotation evidence is not necessarily experimental evidence.", "Mapped construct bars represent source-supported canonical segments, not inferred complete construct termini or complete folded-domain boundaries.", "Isoform rows reuse source-validated PWWP core correspondence; other-domain architectures are not inferred for isoforms.", "Ligand names are linked only through curated assay/preparation records. Structural occupancy, preparation identity, and activity remain separate.", "Missing annotations, contacts, dates, or ligand links indicate missing curation in this snapshot, not biological absence." ] }, "architectures": { "Q586Y0": { "uniprot": "Q586Y0", "gene": "28H13_90", "protein_id": "UP:Q586Y0", "length": 381, "sequence_sha256": "f53ce6173314772e7561d1626c772f5e214b304449a591f0f4b3f6cb42331871", "domains": [ { "domain_id": "UP:Q586Y0:PWWP1", "domain_name": "PWWP1", "start": 7, "end": 68, "source": "UniProtKB DOMAIN", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "Q586Y0:UPFEATURE:1", "type": "Domain", "name": "TFIIS N-terminal", "start": 266, "end": 346, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q586Y0.json", "evidence": [ { "evidenceCode": "ECO:0000259", "source": "PROSITE", "id": "PS51319" } ], "source_index": 1 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q586Y0", "source_url": "https://rest.uniprot.org/uniprotkb/Q586Y0.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q586Y0.json", "retrieved_utc": "2026-10-26T17:49:27.793545+00:00", "source_last_modified": null, "sha256": "f20544f3e2aec26fd7a0df780996d526d172d73e1c33a4dfffe8e715f67e0cbb", "bytes": 15373, "entry_audit": { "firstPublicDate": "2006-05-02", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2006-05-02", "entryVersion": 120, "sequenceVersion": 1 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "f53ce6173314772e7561d1626c772f5e214b304449a591f0f4b3f6cb42331871", "source_sequence_sha256": "f53ce6173314772e7561d1626c772f5e214b304449a591f0f4b3f6cb42331871", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "2NAS", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 1, 110 ] ], "observed_ranges": [ [ 1, 110 ] ], "construct_length": 110, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [], "sequence_mismatches": [], "engineering_status": "no sequence difference detected by mapping; not proof of wild type", "coverage": [ { "domain_id": "UP:Q586Y0:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 62, "annotation_core_length": 62 } ], "source_url": "https://www.rcsb.org/structure/2NAS", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "P29374": { "uniprot": "P29374", "gene": "ARID4A", "protein_id": "UP:P29374", "length": 1257, "sequence_sha256": "93cfe8189194eba375ff888c548971a9eb173c819f9e6988ddc12ef22668691a", "domains": [ { "domain_id": "UP:P29374:PWWP1", "domain_name": "PWWP1", "start": 170, "end": 262, "source": "pfam via InterPro API", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "P29374:UPFEATURE:1", "type": "Domain", "name": "ARID", "start": 309, "end": 401, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/P29374.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00355" } ], "source_index": 1 }, { "feature_id": "P29374:UPFEATURE:2", "type": "Domain", "name": "Tudor-knot", "start": 576, "end": 628, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/P29374.json", "evidence": [ { "evidenceCode": "ECO:0000255" } ], "source_index": 2 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "P29374", "source_url": "https://rest.uniprot.org/uniprotkb/P29374.json", "final_url": "https://rest.uniprot.org/uniprotkb/P29374.json", "retrieved_utc": "2026-10-26T17:49:25.393914+00:00", "source_last_modified": null, "sha256": "c6f2f53270587f2f5e561353c2c4b1b11bad4b65a912ece02d82a22510df37bf", "bytes": 64142, "entry_audit": { "firstPublicDate": "1992-12-01", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2008-09-23", "entryVersion": 214, "sequenceVersion": 3 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "93cfe8189194eba375ff888c548971a9eb173c819f9e6988ddc12ef22668691a", "source_sequence_sha256": "93cfe8189194eba375ff888c548971a9eb173c819f9e6988ddc12ef22668691a", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "7V8N", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 169, 417 ] ], "observed_ranges": [ [ 169, 272 ], [ 303, 417 ] ], "construct_length": 253, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 4 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:P29374:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 93, "annotation_core_length": 93 } ], "source_url": "https://www.rcsb.org/structure/7V8N", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "2YRV", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 170, 273 ] ], "observed_ranges": [ [ 170, 273 ] ], "construct_length": 117, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 7 ], [ 112, 117 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:P29374:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 93, "annotation_core_length": 93 } ], "source_url": "https://www.rcsb.org/structure/2YRV", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "6L87", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 171, 280 ], [ 304, 414 ] ], "observed_ranges": [ [ 171, 280 ], [ 304, 414 ] ], "construct_length": 229, "mapped_sequence_identity": 0.986425, "unmapped_construct_ranges": [ [ 222, 229 ] ], "sequence_mismatches": [ { "construct": "K", "entity_position": 108, "reference": "D", "uniprot_position": 278 }, { "construct": "K", "entity_position": 110, "reference": "E", "uniprot_position": 280 }, { "construct": "K", "entity_position": 112, "reference": "E", "uniprot_position": 305 } ], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:P29374:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 92, "annotation_core_length": 93 } ], "source_url": "https://www.rcsb.org/structure/6L87", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-P29374-2-F1:v6", "model_accession": "P29374-2", "protein_id": "UP:P29374", "sequence_length": 1203, "sequence_sha256": "0054f659d5df7911224a285b317328fe80b5645295b9874f30d1cabb2ff75080", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/P29374", "domain_id": "UP:P29374:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 93, "domain_length": 93, "isoform_start": 170, "isoform_end": 262, "isoform_positions": [ 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/P29374-2" }, { "model_record_id": "AF-P29374-3-F1:v6", "model_accession": "P29374-3", "protein_id": "UP:P29374", "sequence_length": 1188, "sequence_sha256": "8bec80e111c823fafa7ed783d914bb5de7cdeec0d383906a9729edac1d6a27ba", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/P29374", "domain_id": "UP:P29374:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 93, "domain_length": 93, "isoform_start": 170, "isoform_end": 262, "isoform_positions": [ 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/P29374-3" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q4LE39": { "uniprot": "Q4LE39", "gene": "ARID4B", "protein_id": "UP:Q4LE39", "length": 1312, "sequence_sha256": "80db595960b887a3ba804ab3bd2bd3819c08cb58b667fe2741869d5da6b4f0c2", "domains": [ { "domain_id": "UP:Q4LE39:PWWP1", "domain_name": "PWWP1", "start": 170, "end": 262, "source": "pfam via InterPro API", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "Q4LE39:UPFEATURE:1", "type": "Domain", "name": "ARID", "start": 306, "end": 398, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q4LE39.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00355" } ], "source_index": 1 }, { "feature_id": "Q4LE39:UPFEATURE:2", "type": "Domain", "name": "Tudor-knot", "start": 572, "end": 624, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q4LE39.json", "evidence": [ { "evidenceCode": "ECO:0000255" } ], "source_index": 2 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q4LE39", "source_url": "https://rest.uniprot.org/uniprotkb/Q4LE39.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q4LE39.json", "retrieved_utc": "2026-10-26T17:49:27.840674+00:00", "source_last_modified": null, "sha256": "501d2b6c6302e0f4d8959fb0e0c95af684fbd2833afe4fa9b84e59189c1d6e4b", "bytes": 74601, "entry_audit": { "firstPublicDate": "2007-04-03", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2007-04-03", "entryVersion": 172, "sequenceVersion": 2 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "80db595960b887a3ba804ab3bd2bd3819c08cb58b667fe2741869d5da6b4f0c2", "source_sequence_sha256": "80db595960b887a3ba804ab3bd2bd3819c08cb58b667fe2741869d5da6b4f0c2", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-Q4LE39-2-F1:v6", "model_accession": "Q4LE39-2", "protein_id": "UP:Q4LE39", "sequence_length": 1226, "sequence_sha256": "7c85d48d75757e07ce242b9cab9711cf6ff6cc6061531e725e08a1bfb25f0a7b", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q4LE39", "domain_id": "UP:Q4LE39:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 93, "domain_length": 93, "isoform_start": 170, "isoform_end": 262, "isoform_positions": [ 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q4LE39-2" }, { "model_record_id": "AF-Q4LE39-3-F1:v6", "model_accession": "Q4LE39-3", "protein_id": "UP:Q4LE39", "sequence_length": 1153, "sequence_sha256": "baed4a50f69ab7352a723da3ae2dbaa78144c1ffc6830a165b1bdd7d99d74ddc", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q4LE39", "domain_id": "UP:Q4LE39:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 93, "domain_length": 93, "isoform_start": 170, "isoform_end": 262, "isoform_positions": [ 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q4LE39-3" }, { "model_record_id": "AF-Q4LE39-4-F1:v6", "model_accession": "Q4LE39-4", "protein_id": "UP:Q4LE39", "sequence_length": 803, "sequence_sha256": "3884eac78dca950f2da18fd59b7ed6dfc3252a9b2b2e3199a067c4b9f0267aaf", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q4LE39", "domain_id": "UP:Q4LE39:PWWP1", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 93, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q4LE39-4" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "O95696": { "uniprot": "O95696", "gene": "BRD1", "protein_id": "UP:O95696", "length": 1058, "sequence_sha256": "96128c45452bec648cd0e8ac6c91af165d30470abf91590ac847b6b3c765f1c9", "domains": [ { "domain_id": "UP:O95696:PWWP1", "domain_name": "PWWP1", "start": 929, "end": 1012, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "O95696:UPFEATURE:3", "type": "Zinc finger", "name": "PHD-type 1", "start": 214, "end": 264, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/O95696.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00146" } ], "source_index": 3 }, { "feature_id": "O95696:UPFEATURE:4", "type": "Zinc finger", "name": "C2HC pre-PHD-type", "start": 268, "end": 301, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/O95696.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU01146" } ], "source_index": 4 }, { "feature_id": "O95696:UPFEATURE:5", "type": "Zinc finger", "name": "PHD-type 2", "start": 325, "end": 389, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/O95696.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU01146" } ], "source_index": 5 }, { "feature_id": "O95696:UPFEATURE:1", "type": "Domain", "name": "Bromo", "start": 562, "end": 666, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/O95696.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00035" } ], "source_index": 1 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "O95696", "source_url": "https://rest.uniprot.org/uniprotkb/O95696.json", "final_url": "https://rest.uniprot.org/uniprotkb/O95696.json", "retrieved_utc": "2026-10-26T17:49:25.338336+00:00", "source_last_modified": null, "sha256": "a5d32c1541e9694025bc9d7f8cd1a06051b109f7bde70965e1c049cd64dab311", "bytes": 144365, "entry_audit": { "firstPublicDate": "2001-01-11", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "1999-05-01", "entryVersion": 203, "sequenceVersion": 1 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "96128c45452bec648cd0e8ac6c91af165d30470abf91590ac847b6b3c765f1c9", "source_sequence_sha256": "96128c45452bec648cd0e8ac6c91af165d30470abf91590ac847b6b3c765f1c9", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "4Z02", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 925, 1049 ] ], "observed_ranges": [ [ 929, 1047 ] ], "construct_length": 125, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [], "sequence_mismatches": [], "engineering_status": "no sequence difference detected by mapping; not proof of wild type", "coverage": [ { "domain_id": "UP:O95696:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 84, "annotation_core_length": 84 } ], "source_url": "https://www.rcsb.org/structure/4Z02", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-O95696-2-F1:v6", "model_accession": "O95696-2", "protein_id": "UP:O95696", "sequence_length": 1189, "sequence_sha256": "078416750dc37cd7190d0085014a3a973b310275b54c636e18a693724096f453", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/O95696", "domain_id": "UP:O95696:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 84, "domain_length": 84, "isoform_start": 1060, "isoform_end": 1143, "isoform_positions": [ 1060, 1061, 1062, 1063, 1064, 1065, 1066, 1067, 1068, 1069, 1070, 1071, 1072, 1073, 1074, 1075, 1076, 1077, 1078, 1079, 1080, 1081, 1082, 1083, 1084, 1085, 1086, 1087, 1088, 1089, 1090, 1091, 1092, 1093, 1094, 1095, 1096, 1097, 1098, 1099, 1100, 1101, 1102, 1103, 1104, 1105, 1106, 1107, 1108, 1109, 1110, 1111, 1112, 1113, 1114, 1115, 1116, 1117, 1118, 1119, 1120, 1121, 1122, 1123, 1124, 1125, 1126, 1127, 1128, 1129, 1130, 1131, 1132, 1133, 1134, 1135, 1136, 1137, 1138, 1139, 1140, 1141, 1142, 1143 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/O95696-2" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "P55201": { "uniprot": "P55201", "gene": "BRPF1", "protein_id": "UP:P55201", "length": 1214, "sequence_sha256": "f85585cccf1eac4e987a9943ee73c8ba40fe76bfe919b08a974ad70731d8d298", "domains": [ { "domain_id": "UP:P55201:PWWP1", "domain_name": "PWWP1", "start": 1085, "end": 1168, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "P55201:UPFEATURE:3", "type": "Zinc finger", "name": "C2H2-type", "start": 21, "end": 47, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/P55201.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00042" } ], "source_index": 3 }, { "feature_id": "P55201:UPFEATURE:4", "type": "Zinc finger", "name": "PHD-type 1", "start": 273, "end": 323, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/P55201.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00146" } ], "source_index": 4 }, { "feature_id": "P55201:UPFEATURE:5", "type": "Zinc finger", "name": "C2HC pre-PHD-type", "start": 327, "end": 360, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/P55201.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU01146" } ], "source_index": 5 }, { "feature_id": "P55201:UPFEATURE:6", "type": "Zinc finger", "name": "PHD-type 2", "start": 384, "end": 448, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/P55201.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU01146" } ], "source_index": 6 }, { "feature_id": "P55201:UPFEATURE:1", "type": "Domain", "name": "Bromo", "start": 628, "end": 732, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/P55201.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00035" } ], "source_index": 1 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "P55201", "source_url": "https://rest.uniprot.org/uniprotkb/P55201.json", "final_url": "https://rest.uniprot.org/uniprotkb/P55201.json", "retrieved_utc": "2026-10-26T17:49:25.865492+00:00", "source_last_modified": null, "sha256": "ee6509e08e1510e8ceba9c9715d1379de3936cb877e177958600ea90ea723373", "bytes": 91225, "entry_audit": { "firstPublicDate": "1996-10-01", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2006-10-17", "entryVersion": 215, "sequenceVersion": 2 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "f85585cccf1eac4e987a9943ee73c8ba40fe76bfe919b08a974ad70731d8d298", "source_sequence_sha256": "f85585cccf1eac4e987a9943ee73c8ba40fe76bfe919b08a974ad70731d8d298", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "3L42", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 1079, 1207 ] ], "observed_ranges": [ [ 1079, 1205 ] ], "construct_length": 130, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 1 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:P55201:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 84, "annotation_core_length": 84 } ], "source_url": "https://www.rcsb.org/structure/3L42", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "2X35", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 1076, 1205 ] ], "observed_ranges": [ [ 1080, 1204 ] ], "construct_length": 132, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 2 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:P55201:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 84, "annotation_core_length": 84 } ], "source_url": "https://www.rcsb.org/structure/2X35", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-P55201-2-F1:v6", "model_accession": "P55201-2", "protein_id": "UP:P55201", "sequence_length": 1220, "sequence_sha256": "48f08bd5e5a85f77d6dac43152ff4c5c6f95aaf028f6ca4fb652ab0125dfb9cc", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/P55201", "domain_id": "UP:P55201:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 84, "domain_length": 84, "isoform_start": 1091, "isoform_end": 1174, "isoform_positions": [ 1091, 1092, 1093, 1094, 1095, 1096, 1097, 1098, 1099, 1100, 1101, 1102, 1103, 1104, 1105, 1106, 1107, 1108, 1109, 1110, 1111, 1112, 1113, 1114, 1115, 1116, 1117, 1118, 1119, 1120, 1121, 1122, 1123, 1124, 1125, 1126, 1127, 1128, 1129, 1130, 1131, 1132, 1133, 1134, 1135, 1136, 1137, 1138, 1139, 1140, 1141, 1142, 1143, 1144, 1145, 1146, 1147, 1148, 1149, 1150, 1151, 1152, 1153, 1154, 1155, 1156, 1157, 1158, 1159, 1160, 1161, 1162, 1163, 1164, 1165, 1166, 1167, 1168, 1169, 1170, 1171, 1172, 1173, 1174 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/P55201-2" }, { "model_record_id": "AF-P55201-3-F1:v6", "model_accession": "P55201-3", "protein_id": "UP:P55201", "sequence_length": 1213, "sequence_sha256": "c9c21f13ee01932a82252cafe8435b34eba7337a03b38b78d692a2ab08b64bd6", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/P55201", "domain_id": "UP:P55201:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 84, "domain_length": 84, "isoform_start": 1084, "isoform_end": 1167, "isoform_positions": [ 1084, 1085, 1086, 1087, 1088, 1089, 1090, 1091, 1092, 1093, 1094, 1095, 1096, 1097, 1098, 1099, 1100, 1101, 1102, 1103, 1104, 1105, 1106, 1107, 1108, 1109, 1110, 1111, 1112, 1113, 1114, 1115, 1116, 1117, 1118, 1119, 1120, 1121, 1122, 1123, 1124, 1125, 1126, 1127, 1128, 1129, 1130, 1131, 1132, 1133, 1134, 1135, 1136, 1137, 1138, 1139, 1140, 1141, 1142, 1143, 1144, 1145, 1146, 1147, 1148, 1149, 1150, 1151, 1152, 1153, 1154, 1155, 1156, 1157, 1158, 1159, 1160, 1161, 1162, 1163, 1164, 1165, 1166, 1167 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/P55201-3" }, { "model_record_id": "AF-P55201-4-F1:v6", "model_accession": "P55201-4", "protein_id": "UP:P55201", "sequence_length": 1119, "sequence_sha256": "8e68beffb45bbc4a8d3bf08467f188c4b0543cba737a331299f486060f9e7064", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/P55201", "domain_id": "UP:P55201:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 84, "domain_length": 84, "isoform_start": 990, "isoform_end": 1073, "isoform_positions": [ 990, 991, 992, 993, 994, 995, 996, 997, 998, 999, 1000, 1001, 1002, 1003, 1004, 1005, 1006, 1007, 1008, 1009, 1010, 1011, 1012, 1013, 1014, 1015, 1016, 1017, 1018, 1019, 1020, 1021, 1022, 1023, 1024, 1025, 1026, 1027, 1028, 1029, 1030, 1031, 1032, 1033, 1034, 1035, 1036, 1037, 1038, 1039, 1040, 1041, 1042, 1043, 1044, 1045, 1046, 1047, 1048, 1049, 1050, 1051, 1052, 1053, 1054, 1055, 1056, 1057, 1058, 1059, 1060, 1061, 1062, 1063, 1064, 1065, 1066, 1067, 1068, 1069, 1070, 1071, 1072, 1073 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/P55201-4" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q9ULD4": { "uniprot": "Q9ULD4", "gene": "BRPF3", "protein_id": "UP:Q9ULD4", "length": 1205, "sequence_sha256": "b60065cfc6bccc5075590ddfd60fe371e10797422dd2281cac73f41baf0aaf1b", "domains": [ { "domain_id": "UP:Q9ULD4:PWWP1", "domain_name": "PWWP1", "start": 1076, "end": 1159, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "Q9ULD4:UPFEATURE:3", "type": "Zinc finger", "name": "PHD-type 1", "start": 212, "end": 262, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9ULD4.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00146" } ], "source_index": 3 }, { "feature_id": "Q9ULD4:UPFEATURE:4", "type": "Zinc finger", "name": "C2HC pre-PHD-type", "start": 266, "end": 299, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9ULD4.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU01146" } ], "source_index": 4 }, { "feature_id": "Q9ULD4:UPFEATURE:5", "type": "Zinc finger", "name": "PHD-type 2", "start": 323, "end": 387, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9ULD4.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU01146" } ], "source_index": 5 }, { "feature_id": "Q9ULD4:UPFEATURE:1", "type": "Domain", "name": "Bromo", "start": 589, "end": 693, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9ULD4.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00035" } ], "source_index": 1 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q9ULD4", "source_url": "https://rest.uniprot.org/uniprotkb/Q9ULD4.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q9ULD4.json", "retrieved_utc": "2026-10-26T17:49:31.893405+00:00", "source_last_modified": null, "sha256": "668afcbd25c2fdc14bdb8d4143758c0e90f8266b89edff7e596c6e7a23fadedf", "bytes": 51089, "entry_audit": { "firstPublicDate": "2001-01-11", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2005-07-19", "entryVersion": 185, "sequenceVersion": 2 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "b60065cfc6bccc5075590ddfd60fe371e10797422dd2281cac73f41baf0aaf1b", "source_sequence_sha256": "b60065cfc6bccc5075590ddfd60fe371e10797422dd2281cac73f41baf0aaf1b", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "3PFS", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 1056, 1195 ] ], "observed_ranges": [ [ 1061, 1194 ] ], "construct_length": 158, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 18 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:Q9ULD4:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 84, "annotation_core_length": 84 } ], "source_url": "https://www.rcsb.org/structure/3PFS", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-Q9ULD4-2-F1:v6", "model_accession": "Q9ULD4-2", "protein_id": "UP:Q9ULD4", "sequence_length": 935, "sequence_sha256": "8cb017327cf7d9a225823a863f2c3a7db4be10077885e5a14d95533b8db43024", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULD4", "domain_id": "UP:Q9ULD4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 84, "domain_length": 84, "isoform_start": 806, "isoform_end": 889, "isoform_positions": [ 806, 807, 808, 809, 810, 811, 812, 813, 814, 815, 816, 817, 818, 819, 820, 821, 822, 823, 824, 825, 826, 827, 828, 829, 830, 831, 832, 833, 834, 835, 836, 837, 838, 839, 840, 841, 842, 843, 844, 845, 846, 847, 848, 849, 850, 851, 852, 853, 854, 855, 856, 857, 858, 859, 860, 861, 862, 863, 864, 865, 866, 867, 868, 869, 870, 871, 872, 873, 874, 875, 876, 877, 878, 879, 880, 881, 882, 883, 884, 885, 886, 887, 888, 889 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULD4-2" }, { "model_record_id": "AF-Q9ULD4-3-F1:v6", "model_accession": "Q9ULD4-3", "protein_id": "UP:Q9ULD4", "sequence_length": 871, "sequence_sha256": "e15f006fa6db2c468531028d9591a749d2c09282f203c71d9af0d00a85e23371", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULD4", "domain_id": "UP:Q9ULD4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 84, "domain_length": 84, "isoform_start": 742, "isoform_end": 825, "isoform_positions": [ 742, 743, 744, 745, 746, 747, 748, 749, 750, 751, 752, 753, 754, 755, 756, 757, 758, 759, 760, 761, 762, 763, 764, 765, 766, 767, 768, 769, 770, 771, 772, 773, 774, 775, 776, 777, 778, 779, 780, 781, 782, 783, 784, 785, 786, 787, 788, 789, 790, 791, 792, 793, 794, 795, 796, 797, 798, 799, 800, 801, 802, 803, 804, 805, 806, 807, 808, 809, 810, 811, 812, 813, 814, 815, 816, 817, 818, 819, 820, 821, 822, 823, 824, 825 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULD4-3" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q9Y6K1": { "uniprot": "Q9Y6K1", "gene": "DNMT3A", "protein_id": "UP:Q9Y6K1", "length": 912, "sequence_sha256": "52ea10c47364c98bc0b066941229148e42ad779b70b1b8569855db412b95cacd", "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "domain_name": "PWWP1", "start": 292, "end": 350, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "Q9Y6K1:UPFEATURE:2", "type": "Domain", "name": "ADD", "start": 482, "end": 614, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9Y6K1.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00865" } ], "source_index": 2 }, { "feature_id": "Q9Y6K1:UPFEATURE:4", "type": "Zinc finger", "name": "GATA-type; atypical", "start": 493, "end": 523, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9Y6K1.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00865" } ], "source_index": 4 }, { "feature_id": "Q9Y6K1:UPFEATURE:5", "type": "Zinc finger", "name": "PHD-type; atypical", "start": 534, "end": 590, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9Y6K1.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00865" } ], "source_index": 5 }, { "feature_id": "Q9Y6K1:UPFEATURE:3", "type": "Domain", "name": "SAM-dependent MTase C5-type", "start": 634, "end": 912, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9Y6K1.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU01016" } ], "source_index": 3 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q9Y6K1", "source_url": "https://rest.uniprot.org/uniprotkb/Q9Y6K1.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q9Y6K1.json", "retrieved_utc": "2026-10-26T17:49:32.811797+00:00", "source_last_modified": null, "sha256": "fe28166103fdd6b88e81241b5a6a5bf6fc153b0811ad9d3128a42304bca724c3", "bytes": 115767, "entry_audit": { "firstPublicDate": "2001-09-26", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2008-01-15", "entryVersion": 213, "sequenceVersion": 4 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "52ea10c47364c98bc0b066941229148e42ad779b70b1b8569855db412b95cacd", "source_sequence_sha256": "52ea10c47364c98bc0b066941229148e42ad779b70b1b8569855db412b95cacd", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "3LLR", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 275, 427 ] ], "observed_ranges": [ [ 283, 385 ], [ 398, 425 ] ], "construct_length": 154, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 1 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 59, "annotation_core_length": 59 } ], "source_url": "https://www.rcsb.org/structure/3LLR", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "11NZ", "chain": "B", "auth_chains": [ "B" ], "mapped_ranges": [ [ 281, 912 ] ], "observed_ranges": [ [ 289, 383 ], [ 395, 424 ], [ 469, 912 ] ], "construct_length": 633, "mapped_sequence_identity": 0.998418, "unmapped_construct_ranges": [ [ 1, 1 ] ], "sequence_mismatches": [ { "construct": "H", "entity_position": 603, "reference": "R", "uniprot_position": 882 } ], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 59, "annotation_core_length": 59 } ], "source_url": "https://www.rcsb.org/structure/11NZ", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "9E05", "chain": "V", "auth_chains": [ "Y" ], "mapped_ranges": [ [ 224, 912 ] ], "observed_ranges": [ [ 283, 385 ], [ 398, 425 ], [ 476, 832 ], [ 846, 912 ] ], "construct_length": 689, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [], "sequence_mismatches": [], "engineering_status": "no sequence difference detected by mapping; not proof of wild type", "coverage": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 59, "annotation_core_length": 59 } ], "source_url": "https://www.rcsb.org/structure/9E05", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-Q9Y6K1-2-F1:v6", "model_accession": "Q9Y6K1-2", "protein_id": "UP:Q9Y6K1", "sequence_length": 723, "sequence_sha256": "ad517c264e09806668f9e9a3b25decc751f9eec0795e556a29d6d098ab273642", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9Y6K1", "domain_id": "UP:Q9Y6K1:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 59, "domain_length": 59, "isoform_start": 103, "isoform_end": 161, "isoform_positions": [ 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9Y6K1-2" }, { "model_record_id": "AF-Q9Y6K1-3-F1:v6", "model_accession": "Q9Y6K1-3", "protein_id": "UP:Q9Y6K1", "sequence_length": 166, "sequence_sha256": "ea3268a76593cf78ba4e252a01a2ce86f4888d41bea54ccf058e2af22e1dae27", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9Y6K1", "domain_id": "UP:Q9Y6K1:PWWP1", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 59, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9Y6K1-3" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q9UBC3": { "uniprot": "Q9UBC3", "gene": "DNMT3B", "protein_id": "UP:Q9UBC3", "length": 853, "sequence_sha256": "98ed5e5f7c4fc9e0acd126b62a1fac341002445bb7a1a258151475199216e0ec", "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "domain_name": "PWWP1", "start": 225, "end": 283, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "Q9UBC3:UPFEATURE:2", "type": "Domain", "name": "ADD", "start": 423, "end": 555, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9UBC3.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00865" } ], "source_index": 2 }, { "feature_id": "Q9UBC3:UPFEATURE:4", "type": "Zinc finger", "name": "GATA-type; atypical", "start": 434, "end": 464, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9UBC3.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00865" } ], "source_index": 4 }, { "feature_id": "Q9UBC3:UPFEATURE:5", "type": "Zinc finger", "name": "PHD-type; atypical", "start": 475, "end": 531, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9UBC3.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00865" } ], "source_index": 5 }, { "feature_id": "Q9UBC3:UPFEATURE:3", "type": "Domain", "name": "SAM-dependent MTase C5-type", "start": 575, "end": 853, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9UBC3.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU01016" } ], "source_index": 3 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q9UBC3", "source_url": "https://rest.uniprot.org/uniprotkb/Q9UBC3.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q9UBC3.json", "retrieved_utc": "2026-10-26T17:49:32.156223+00:00", "source_last_modified": null, "sha256": "e1c59e92259d45180e671638410e978b96950491a07290ca55532fa881ed412b", "bytes": 105850, "entry_audit": { "firstPublicDate": "2001-09-26", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2000-05-01", "entryVersion": 231, "sequenceVersion": 1 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "98ed5e5f7c4fc9e0acd126b62a1fac341002445bb7a1a258151475199216e0ec", "source_sequence_sha256": "98ed5e5f7c4fc9e0acd126b62a1fac341002445bb7a1a258151475199216e0ec", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "5NRR", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 206, 355 ] ], "observed_ranges": [ [ 213, 319 ], [ 324, 351 ] ], "construct_length": 150, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [], "sequence_mismatches": [], "engineering_status": "no sequence difference detected by mapping; not proof of wild type", "coverage": [ { "domain_id": "UP:Q9UBC3:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 59, "annotation_core_length": 59 } ], "source_url": "https://www.rcsb.org/structure/5NRR", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "6R3E", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 215, 351 ] ], "observed_ranges": [ [ 215, 319 ], [ 324, 351 ] ], "construct_length": 274, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [], "sequence_mismatches": [], "engineering_status": "no sequence difference detected by mapping; not proof of wild type", "coverage": [ { "domain_id": "UP:Q9UBC3:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 59, "annotation_core_length": 59 } ], "source_url": "https://www.rcsb.org/structure/6R3E", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "8EIH", "chain": "E", "auth_chains": [ "E" ], "mapped_ranges": [ [ 206, 853 ] ], "observed_ranges": [ [ 216, 313 ], [ 327, 350 ] ], "construct_length": 650, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 2 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:Q9UBC3:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 59, "annotation_core_length": 59 } ], "source_url": "https://www.rcsb.org/structure/8EIH", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-Q9UBC3-2-F1:v6", "model_accession": "Q9UBC3-2", "protein_id": "UP:Q9UBC3", "sequence_length": 833, "sequence_sha256": "30cf31a8b6b81cd7eb5d2fa5c633f7ffef57aebc11d8a4b7975639657a31edcc", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9UBC3", "domain_id": "UP:Q9UBC3:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 59, "domain_length": 59, "isoform_start": 225, "isoform_end": 283, "isoform_positions": [ 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9UBC3-2" }, { "model_record_id": "AF-Q9UBC3-3-F1:v6", "model_accession": "Q9UBC3-3", "protein_id": "UP:Q9UBC3", "sequence_length": 770, "sequence_sha256": "569ef216068cad70b18883b0b7f6efb3e41ad85ddee516e45e54198fac7ba001", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9UBC3", "domain_id": "UP:Q9UBC3:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 59, "domain_length": 59, "isoform_start": 225, "isoform_end": 283, "isoform_positions": [ 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9UBC3-3" }, { "model_record_id": "AF-Q9UBC3-4-F1:v6", "model_accession": "Q9UBC3-4", "protein_id": "UP:Q9UBC3", "sequence_length": 724, "sequence_sha256": "6d8d8771cdc2dc404d87fc9ca3bf15ba222f7e815db0ac36d5dcd6dc3b2b1708", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9UBC3", "domain_id": "UP:Q9UBC3:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 59, "domain_length": 59, "isoform_start": 225, "isoform_end": 283, "isoform_positions": [ 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9UBC3-4" }, { "model_record_id": "AF-Q9UBC3-5-F1:v6", "model_accession": "Q9UBC3-5", "protein_id": "UP:Q9UBC3", "sequence_length": 792, "sequence_sha256": "f64a296f7a11c61a40f0cb5555c18e9cccdad489926751e85d0bb1ea119c1aec", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9UBC3", "domain_id": "UP:Q9UBC3:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 59, "domain_length": 59, "isoform_start": 225, "isoform_end": 283, "isoform_positions": [ 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9UBC3-5" }, { "model_record_id": "AF-Q9UBC3-6-F1:v6", "model_accession": "Q9UBC3-6", "protein_id": "UP:Q9UBC3", "sequence_length": 845, "sequence_sha256": "3384643ac318c24c60168164cf691d7b44c51ddc19e849b9e14970c87e0b08c7", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9UBC3", "domain_id": "UP:Q9UBC3:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 59, "domain_length": 59, "isoform_start": 237, "isoform_end": 295, "isoform_positions": [ 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9UBC3-6" }, { "model_record_id": "AF-Q9UBC3-7-F1:v6", "model_accession": "Q9UBC3-7", "protein_id": "UP:Q9UBC3", "sequence_length": 694, "sequence_sha256": "6b7f886f7508d287469a7416e8115452b0a0c6b08248bc82fbb78e9bd60eb922", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9UBC3", "domain_id": "UP:Q9UBC3:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 59, "domain_length": 59, "isoform_start": 149, "isoform_end": 207, "isoform_positions": [ 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9UBC3-7" }, { "model_record_id": "AF-Q9UBC3-8-F1:v6", "model_accession": "Q9UBC3-8", "protein_id": "UP:Q9UBC3", "sequence_length": 728, "sequence_sha256": "2885321b2707e97501a9192d33c806c0a641f38a9d80cccd7cba70157e2c57e7", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9UBC3", "domain_id": "UP:Q9UBC3:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 59, "domain_length": 59, "isoform_start": 183, "isoform_end": 241, "isoform_positions": [ 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9UBC3-8" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "O88509": { "uniprot": "O88509", "gene": "Dnmt3b", "protein_id": "UP:O88509", "length": 859, "sequence_sha256": "1c5d6422c8058325d6c2a680da65520669e2de5f1cb850641c0db20e6a989e4e", "domains": [ { "domain_id": "UP:O88509:PWWP1", "domain_name": "PWWP1", "start": 232, "end": 290, "source": "UniProtKB DOMAIN", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "O88509:UPFEATURE:2", "type": "Domain", "name": "ADD", "start": 428, "end": 560, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/O88509.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00865" } ], "source_index": 2 }, { "feature_id": "O88509:UPFEATURE:4", "type": "Zinc finger", "name": "GATA-type; atypical", "start": 439, "end": 469, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/O88509.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00865" } ], "source_index": 4 }, { "feature_id": "O88509:UPFEATURE:5", "type": "Zinc finger", "name": "PHD-type; atypical", "start": 480, "end": 536, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/O88509.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00865" } ], "source_index": 5 }, { "feature_id": "O88509:UPFEATURE:3", "type": "Domain", "name": "SAM-dependent MTase C5-type", "start": 581, "end": 859, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/O88509.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU01016" } ], "source_index": 3 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "O88509", "source_url": "https://rest.uniprot.org/uniprotkb/O88509.json", "final_url": "https://rest.uniprot.org/uniprotkb/O88509.json", "retrieved_utc": "2026-10-26T17:49:25.025862+00:00", "source_last_modified": null, "sha256": "841a2b57223e69dabb529ab86570c024220bdc15c3e31fdd35f60431763ca968", "bytes": 55252, "entry_audit": { "firstPublicDate": "2001-09-26", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2000-05-01", "entryVersion": 206, "sequenceVersion": 2 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "1c5d6422c8058325d6c2a680da65520669e2de5f1cb850641c0db20e6a989e4e", "source_sequence_sha256": "1c5d6422c8058325d6c2a680da65520669e2de5f1cb850641c0db20e6a989e4e", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "1KHC", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 219, 362 ] ], "observed_ranges": [ [ 222, 358 ] ], "construct_length": 147, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 145, 147 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:O88509:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 59, "annotation_core_length": 59 } ], "source_url": "https://www.rcsb.org/structure/1KHC", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-O88509-2-F1:v6", "model_accession": "O88509-2", "protein_id": "UP:O88509", "sequence_length": 839, "sequence_sha256": "49cedc17f87fd9da255dd7e57380eb6b6fcdf29f35de183695971b31e5ec3333", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/O88509", "domain_id": "UP:O88509:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 59, "domain_length": 59, "isoform_start": 232, "isoform_end": 290, "isoform_positions": [ 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/O88509-2" }, { "model_record_id": "AF-O88509-3-F1:v6", "model_accession": "O88509-3", "protein_id": "UP:O88509", "sequence_length": 776, "sequence_sha256": "1d89e21e3cb739203a6f71e3ded5f6172bedf5961eff93ab1f4b22873236f352", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/O88509", "domain_id": "UP:O88509:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 59, "domain_length": 59, "isoform_start": 232, "isoform_end": 290, "isoform_positions": [ 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/O88509-3" }, { "model_record_id": "AF-O88509-4-F1:v6", "model_accession": "O88509-4", "protein_id": "UP:O88509", "sequence_length": 796, "sequence_sha256": "11c9ee5fc943211beafc54dae50dd338e6e5f877ee7e046b9c40f3868043d0eb", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/O88509", "domain_id": "UP:O88509:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 59, "domain_length": 59, "isoform_start": 232, "isoform_end": 290, "isoform_positions": [ 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/O88509-4" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q49A26": { "uniprot": "Q49A26", "gene": "GLYR1", "protein_id": "UP:Q49A26", "length": 553, "sequence_sha256": "8daefbe50436321fad61a41f064db4bcddebb0de367e312633af54b9bc1b2c83", "domains": [ { "domain_id": "UP:Q49A26:PWWP1", "domain_name": "PWWP1", "start": 8, "end": 66, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q49A26", "source_url": "https://rest.uniprot.org/uniprotkb/Q49A26.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q49A26.json", "retrieved_utc": "2026-10-26T17:49:26.891049+00:00", "source_last_modified": null, "sha256": "c262e8e8539f5bf978ddff2530e44dad206bf1b9e8670572eb3c6923dada7e57", "bytes": 70457, "entry_audit": { "firstPublicDate": "2007-12-04", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2018-10-10", "entryVersion": 173, "sequenceVersion": 4 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "8daefbe50436321fad61a41f064db4bcddebb0de367e312633af54b9bc1b2c83", "source_sequence_sha256": "8daefbe50436321fad61a41f064db4bcddebb0de367e312633af54b9bc1b2c83", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-Q49A26-2-F1:v6", "model_accession": "Q49A26-2", "protein_id": "UP:Q49A26", "sequence_length": 536, "sequence_sha256": "dc57323da1a41831b31acdaee4f22ff813100c4c4abead13b6d22a9a88d883f3", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q49A26", "domain_id": "UP:Q49A26:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 59, "domain_length": 59, "isoform_start": 8, "isoform_end": 66, "isoform_positions": [ 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q49A26-2" }, { "model_record_id": "AF-Q49A26-3-F1:v6", "model_accession": "Q49A26-3", "protein_id": "UP:Q49A26", "sequence_length": 547, "sequence_sha256": "3dae24117c65043b5013dbeb753d41bc767a855f9d4a72cf420ab43abdfd77bf", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q49A26", "domain_id": "UP:Q49A26:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 59, "domain_length": 59, "isoform_start": 8, "isoform_end": 66, "isoform_positions": [ 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q49A26-3" }, { "model_record_id": "AF-Q49A26-4-F1:v6", "model_accession": "Q49A26-4", "protein_id": "UP:Q49A26", "sequence_length": 484, "sequence_sha256": "df67b1a064ce94390216cdca0666e2977eaac0d93e1dcf582be9a61b5605c862", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q49A26", "domain_id": "UP:Q49A26:PWWP1", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 59, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q49A26-4" }, { "model_record_id": "AF-Q49A26-5-F1:v6", "model_accession": "Q49A26-5", "protein_id": "UP:Q49A26", "sequence_length": 472, "sequence_sha256": "28b91c5569cb73de2b1c7184712f87cac8072092c07d6e199a4076362ba6ec31", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q49A26", "domain_id": "UP:Q49A26:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 59, "domain_length": 59, "isoform_start": 8, "isoform_end": 66, "isoform_positions": [ 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q49A26-5" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "P51858": { "uniprot": "P51858", "gene": "HDGF", "protein_id": "UP:P51858", "length": 240, "sequence_sha256": "5f455d36bf6f5d0b18a92965a3bbc52ca730e286e019bb924a44af77e04053a6", "domains": [ { "domain_id": "UP:P51858:PWWP1", "domain_name": "PWWP1", "start": 12, "end": 69, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "P51858", "source_url": "https://rest.uniprot.org/uniprotkb/P51858.json", "final_url": "https://rest.uniprot.org/uniprotkb/P51858.json", "retrieved_utc": "2026-10-26T17:49:25.888519+00:00", "source_last_modified": null, "sha256": "eebc4a6dff8aa86c1b813266d3789e9c6cb8a8905843a468af3027d34add4fc4", "bytes": 65347, "entry_audit": { "firstPublicDate": "1996-10-01", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "1996-10-01", "entryVersion": 212, "sequenceVersion": 1 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "5f455d36bf6f5d0b18a92965a3bbc52ca730e286e019bb924a44af77e04053a6", "source_sequence_sha256": "5f455d36bf6f5d0b18a92965a3bbc52ca730e286e019bb924a44af77e04053a6", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "1RI0", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 1, 100 ] ], "observed_ranges": [ [ 1, 100 ] ], "construct_length": 110, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 10 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:P51858:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 58, "annotation_core_length": 58 } ], "source_url": "https://www.rcsb.org/structure/1RI0", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-P51858-2-F1:v6", "model_accession": "P51858-2", "protein_id": "UP:P51858", "sequence_length": 233, "sequence_sha256": "619c8ee578e15a475bd4eef10abdf0b8a41c3971edf02c10dbb122770c18150c", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/P51858", "domain_id": "UP:P51858:PWWP1", "core_retention": "partial", "mapped_observed_core_residues": 40, "domain_length": 58, "isoform_start": 23, "isoform_end": 62, "isoform_positions": [ 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62 ], "domain_name": "PWWP1", "validated_edits": [ { "VSP_id": "VSP_045620", "canonical_start": 1, "canonical_end": 29, "kind": "unequal_length_replacement", "replacement_length": 22, "core_overlap_residues": 18, "replacement_sequence": "MEQRAGGNRVQTSTLNCAGAAV" } ], "correction_note": "Unequal N-terminal replacement has no unambiguous residue-by-residue canonical correspondence; do not count coincidental alignment matches as retained core.", "source_url": "https://www.uniprot.org/uniprotkb/P51858-2" }, { "model_record_id": "AF-P51858-3-F1:v6", "model_accession": "P51858-3", "protein_id": "UP:P51858", "sequence_length": 256, "sequence_sha256": "28375d4820a71da779465b3cce5eb9f594fec7bf371e7088a6bbed3b62d110cc", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/P51858", "domain_id": "UP:P51858:PWWP1", "core_retention": "partial", "mapped_observed_core_residues": 40, "domain_length": 58, "isoform_start": 46, "isoform_end": 85, "isoform_positions": [ 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 ], "domain_name": "PWWP1", "validated_edits": [ { "VSP_id": "VSP_047328", "canonical_start": 1, "canonical_end": 29, "kind": "unequal_length_replacement", "replacement_length": 45, "core_overlap_residues": 18, "replacement_sequence": "MHPEGGQFVPQLLGHLLATKLKRFLLSKGGRRAQIPDVSRATPHT" } ], "correction_note": "Unequal N-terminal replacement has no unambiguous residue-by-residue canonical correspondence; do not count coincidental alignment matches as retained core.", "source_url": "https://www.uniprot.org/uniprotkb/P51858-3" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q5TGJ6": { "uniprot": "Q5TGJ6", "gene": "HDGFL1", "protein_id": "UP:Q5TGJ6", "length": 251, "sequence_sha256": "4be2ca7f4b4ff0b908872fa73d6254be9a2210f8d9782b8f5db8c21caf678a60", "domains": [ { "domain_id": "UP:Q5TGJ6:PWWP1", "domain_name": "PWWP1", "start": 11, "end": 62, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q5TGJ6", "source_url": "https://rest.uniprot.org/uniprotkb/Q5TGJ6.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q5TGJ6.json", "retrieved_utc": "2026-10-26T17:49:28.819548+00:00", "source_last_modified": null, "sha256": "63336e68baec2f5929dc85a213dc35bf910866395c1de1d15ef20b3cc0629d72", "bytes": 17449, "entry_audit": { "firstPublicDate": "2008-05-20", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2004-12-21", "entryVersion": 131, "sequenceVersion": 1 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "4be2ca7f4b4ff0b908872fa73d6254be9a2210f8d9782b8f5db8c21caf678a60", "source_sequence_sha256": "4be2ca7f4b4ff0b908872fa73d6254be9a2210f8d9782b8f5db8c21caf678a60", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q7Z4V5": { "uniprot": "Q7Z4V5", "gene": "HDGFL2", "protein_id": "UP:Q7Z4V5", "length": 671, "sequence_sha256": "0632d425ca63a49d9bb1a592942716de7601d7d9a11afb83949548c534b779dd", "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "domain_name": "PWWP1", "start": 7, "end": 64, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q7Z4V5", "source_url": "https://rest.uniprot.org/uniprotkb/Q7Z4V5.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q7Z4V5.json", "retrieved_utc": "2026-10-26T17:49:28.853510+00:00", "source_last_modified": null, "sha256": "32b30ddbad8634f246a9385b702c01566c8d18c20d3f4360e1a9d711a0d19cba", "bytes": 72609, "entry_audit": { "firstPublicDate": "2008-02-05", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2003-10-01", "entryVersion": 175, "sequenceVersion": 1 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "0632d425ca63a49d9bb1a592942716de7601d7d9a11afb83949548c534b779dd", "source_sequence_sha256": "0632d425ca63a49d9bb1a592942716de7601d7d9a11afb83949548c534b779dd", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "8Z6O", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 1, 93 ] ], "observed_ranges": [ [ 3, 93 ] ], "construct_length": 93, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [], "sequence_mismatches": [], "engineering_status": "no sequence difference detected by mapping; not proof of wild type", "coverage": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 58, "annotation_core_length": 58 } ], "source_url": "https://www.rcsb.org/structure/8Z6O", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-Q7Z4V5-2-F1:v6", "model_accession": "Q7Z4V5-2", "protein_id": "UP:Q7Z4V5", "sequence_length": 670, "sequence_sha256": "13a86353f5a08a5b00d1edccb8e2f0ddde63a947e2fa591603a4d72404759bf4", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q7Z4V5", "domain_id": "UP:Q7Z4V5:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 58, "domain_length": 58, "isoform_start": 7, "isoform_end": 64, "isoform_positions": [ 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q7Z4V5-2" }, { "model_record_id": "AF-Q7Z4V5-3-F1:v6", "model_accession": "Q7Z4V5-3", "protein_id": "UP:Q7Z4V5", "sequence_length": 676, "sequence_sha256": "59df0c2fc29dd66df76d5365eb75c305659414294782445f0c2e8053063833c2", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q7Z4V5", "domain_id": "UP:Q7Z4V5:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 58, "domain_length": 58, "isoform_start": 7, "isoform_end": 64, "isoform_positions": [ 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q7Z4V5-3" }, { "model_record_id": "AF-Q7Z4V5-4-F1:v6", "model_accession": "Q7Z4V5-4", "protein_id": "UP:Q7Z4V5", "sequence_length": 675, "sequence_sha256": "358585f1ff9893d12224f29daae0b48c57eef01600cb8e7286201e8a244e57ff", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q7Z4V5", "domain_id": "UP:Q7Z4V5:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 58, "domain_length": 58, "isoform_start": 7, "isoform_end": 64, "isoform_positions": [ 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q7Z4V5-4" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q9Y3E1": { "uniprot": "Q9Y3E1", "gene": "HDGFL3", "protein_id": "UP:Q9Y3E1", "length": 203, "sequence_sha256": "a1d99c34eb83960002f21423c5ba1db47d287c107a850d5dc14ccf73eb8da9bc", "domains": [ { "domain_id": "UP:Q9Y3E1:PWWP1", "domain_name": "PWWP1", "start": 11, "end": 68, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q9Y3E1", "source_url": "https://rest.uniprot.org/uniprotkb/Q9Y3E1.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q9Y3E1.json", "retrieved_utc": "2026-10-26T17:49:32.807164+00:00", "source_last_modified": null, "sha256": "574e68f49a92ac266b89ec8a93be290d8371b4267cef183d2e36f6f8428de84b", "bytes": 25010, "entry_audit": { "firstPublicDate": "2005-06-21", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "1999-11-01", "entryVersion": 177, "sequenceVersion": 1 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "a1d99c34eb83960002f21423c5ba1db47d287c107a850d5dc14ccf73eb8da9bc", "source_sequence_sha256": "a1d99c34eb83960002f21423c5ba1db47d287c107a850d5dc14ccf73eb8da9bc", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "6IIP", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 8, 94 ] ], "observed_ranges": [ [ 8, 94 ] ], "construct_length": 88, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 1 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:Q9Y3E1:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 58, "annotation_core_length": 58 } ], "source_url": "https://www.rcsb.org/structure/6IIP", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "6IIQ", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 1, 99 ] ], "observed_ranges": [ [ 1, 99 ] ], "construct_length": 100, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 1 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:Q9Y3E1:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 58, "annotation_core_length": 58 } ], "source_url": "https://www.rcsb.org/structure/6IIQ", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q8VHK7": { "uniprot": "Q8VHK7", "gene": "Hdgf", "protein_id": "UP:Q8VHK7", "length": 237, "sequence_sha256": "321b1de17212fb5c7a3dd32806abb060d882364ca778d1c82f90c6dd4e2f6d06", "domains": [ { "domain_id": "UP:Q8VHK7:PWWP1", "domain_name": "PWWP1", "start": 12, "end": 69, "source": "UniProtKB DOMAIN", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q8VHK7", "source_url": "https://rest.uniprot.org/uniprotkb/Q8VHK7.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q8VHK7.json", "retrieved_utc": "2026-10-26T17:49:29.853558+00:00", "source_last_modified": null, "sha256": "5bbfd9e73fc1e539f26223922c1dd7b2f7dd8d5ccba48f1c6d0d9a78fb825d0e", "bytes": 28635, "entry_audit": { "firstPublicDate": "2004-04-13", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2004-09-27", "entryVersion": 144, "sequenceVersion": 2 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "321b1de17212fb5c7a3dd32806abb060d882364ca778d1c82f90c6dd4e2f6d06", "source_sequence_sha256": "321b1de17212fb5c7a3dd32806abb060d882364ca778d1c82f90c6dd4e2f6d06", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "5XSK", "chain": "C", "auth_chains": [ "A" ], "mapped_ranges": [ [ 1, 100 ] ], "observed_ranges": [ [ 8, 97 ] ], "construct_length": 120, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 20 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:Q8VHK7:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 58, "annotation_core_length": 58 } ], "source_url": "https://www.rcsb.org/structure/5XSK", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "2B8A", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 1, 110 ] ], "observed_ranges": [ [ 1, 110 ] ], "construct_length": 110, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [], "sequence_mismatches": [], "engineering_status": "no sequence difference detected by mapping; not proof of wild type", "coverage": [ { "domain_id": "UP:Q8VHK7:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 58, "annotation_core_length": 58 } ], "source_url": "https://www.rcsb.org/structure/2B8A", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q9JMG7": { "uniprot": "Q9JMG7", "gene": "Hdgfl3", "protein_id": "UP:Q9JMG7", "length": 202, "sequence_sha256": "53cc4f96c42ef0d615e427eee36886fc91f0a4077ee5eeed8196e22c4158c5e0", "domains": [ { "domain_id": "UP:Q9JMG7:PWWP1", "domain_name": "PWWP1", "start": 11, "end": 68, "source": "UniProtKB DOMAIN", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q9JMG7", "source_url": "https://rest.uniprot.org/uniprotkb/Q9JMG7.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q9JMG7.json", "retrieved_utc": "2026-10-26T17:49:30.853100+00:00", "source_last_modified": null, "sha256": "0bf164ba8f43b4a4dbee231c4fc9bbd447799dc3b9617b26781110f62fc72e20", "bytes": 23361, "entry_audit": { "firstPublicDate": "2005-06-21", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2005-06-21", "entryVersion": 157, "sequenceVersion": 2 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "53cc4f96c42ef0d615e427eee36886fc91f0a4077ee5eeed8196e22c4158c5e0", "source_sequence_sha256": "53cc4f96c42ef0d615e427eee36886fc91f0a4077ee5eeed8196e22c4158c5e0", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "1N27", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 8, 90 ] ], "observed_ranges": [ [ 8, 90 ] ], "construct_length": 96, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 7 ], [ 91, 96 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:Q9JMG7:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 58, "annotation_core_length": 58 } ], "source_url": "https://www.rcsb.org/structure/1N27", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-Q9JMG7-2-F1:v6", "model_accession": "Q9JMG7-2", "protein_id": "UP:Q9JMG7", "sequence_length": 205, "sequence_sha256": "e92e971485a956045a6bce8b5a3f3d37a9939cecebf1cec4ebfc9a1b71e6af09", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9JMG7", "domain_id": "UP:Q9JMG7:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 58, "domain_length": 58, "isoform_start": 11, "isoform_end": 68, "isoform_positions": [ 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9JMG7-2" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q04213": { "uniprot": "Q04213", "gene": "IOC4", "protein_id": "UP:Q04213", "length": 475, "sequence_sha256": "76da708046feb28ab2699f5c350ccd3a3b382d41da1d448d6b85493a2138a095", "domains": [ { "domain_id": "UP:Q04213:PWWP1", "domain_name": "PWWP1", "start": 10, "end": 160, "source": "InterPro/Pfam PF00855", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q04213", "source_url": "https://rest.uniprot.org/uniprotkb/Q04213.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q04213.json", "retrieved_utc": "2026-10-26T17:49:25.842337+00:00", "source_last_modified": null, "sha256": "05f67a4b4a1047320b071cf91045b4b153e9b88c4ae7e95a845ca6fed97441c4", "bytes": 21529, "entry_audit": { "firstPublicDate": "1997-11-01", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "1997-11-01", "entryVersion": 169, "sequenceVersion": 1 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "76da708046feb28ab2699f5c350ccd3a3b382d41da1d448d6b85493a2138a095", "source_sequence_sha256": "76da708046feb28ab2699f5c350ccd3a3b382d41da1d448d6b85493a2138a095", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "7E29", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 1, 178 ] ], "observed_ranges": [ [ 1, 18 ], [ 20, 42 ], [ 92, 174 ] ], "construct_length": 551, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 373 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:Q04213:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 101, "annotation_core_length": 151 } ], "source_url": "https://www.rcsb.org/structure/7E29", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q15652": { "uniprot": "Q15652", "gene": "JMJD1C", "protein_id": "UP:Q15652", "length": 2540, "sequence_sha256": "e3a3bd4e2dd2508c8b37c9e6607af77fa572a28b76f0213f87edc891b49167ab", "domains": [ { "domain_id": "UP:Q15652:PWWP1", "domain_name": "PWWP1", "start": 81, "end": 179, "source": "pfam via InterPro API", "membership_tier": "predicted_PWWP_like", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "Q15652:UPFEATURE:2", "type": "Zinc finger", "name": "C6-type", "start": 1846, "end": 1871, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q15652.json", "evidence": [ { "evidenceCode": "ECO:0000255" } ], "source_index": 2 }, { "feature_id": "Q15652:UPFEATURE:1", "type": "Domain", "name": "JmjC", "start": 2274, "end": 2498, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q15652.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00538" } ], "source_index": 1 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q15652", "source_url": "https://rest.uniprot.org/uniprotkb/Q15652.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q15652.json", "retrieved_utc": "2026-10-26T17:49:26.890925+00:00", "source_last_modified": null, "sha256": "8aae7d703355801d1a0201aea971fafaa033ef45b0063137ca8a400b8b2f7c39", "bytes": 67992, "entry_audit": { "firstPublicDate": "1997-11-01", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2006-01-10", "entryVersion": 188, "sequenceVersion": 2 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "e3a3bd4e2dd2508c8b37c9e6607af77fa572a28b76f0213f87edc891b49167ab", "source_sequence_sha256": "e3a3bd4e2dd2508c8b37c9e6607af77fa572a28b76f0213f87edc891b49167ab", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-Q15652-2-F1:v6", "model_accession": "Q15652-2", "protein_id": "UP:Q15652", "sequence_length": 1480, "sequence_sha256": "5489e647574dc6f022e1d296dd9b65192b7a571f40e8cf2c67fe24d51cb4b2f2", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q15652", "domain_id": "UP:Q15652:PWWP1", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 99, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q15652-2" }, { "model_record_id": "AF-Q15652-3-F1:v6", "model_accession": "Q15652-3", "protein_id": "UP:Q15652", "sequence_length": 2358, "sequence_sha256": "2e32a21ba68b47fdbe761845637b9822b6db881043a59ad560f85cd5115c1482", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q15652", "domain_id": "UP:Q15652:PWWP1", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 99, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q15652-3" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q9VAA9": { "uniprot": "Q9VAA9", "gene": "Jasper", "protein_id": "UP:Q9VAA9", "length": 475, "sequence_sha256": "78332e3bed19b7f75a0d27a06690d1e11bd6d983d23c7e6c01b6f2eeebf1ae27", "domains": [ { "domain_id": "UP:Q9VAA9:PWWP1", "domain_name": "PWWP1", "start": 12, "end": 63, "source": "UniProtKB DOMAIN", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q9VAA9", "source_url": "https://rest.uniprot.org/uniprotkb/Q9VAA9.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q9VAA9.json", "retrieved_utc": "2026-10-26T17:49:31.848190+00:00", "source_last_modified": null, "sha256": "074f39cb4947d10d2039f2aeb43ef0a6eecddd86e1d9d5fe06eedd76531fe0dc", "bytes": 28031, "entry_audit": { "firstPublicDate": "2000-05-01", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2000-05-01", "entryVersion": 192, "sequenceVersion": 1 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "78332e3bed19b7f75a0d27a06690d1e11bd6d983d23c7e6c01b6f2eeebf1ae27", "source_sequence_sha256": "78332e3bed19b7f75a0d27a06690d1e11bd6d983d23c7e6c01b6f2eeebf1ae27", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "6KCO", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 8, 91 ] ], "observed_ranges": [ [ 8, 90 ] ], "construct_length": 85, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 1 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:Q9VAA9:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 52, "annotation_core_length": 52 } ], "source_url": "https://www.rcsb.org/structure/6KCO", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q9Y4C1": { "uniprot": "Q9Y4C1", "gene": "KDM3A", "protein_id": "UP:Q9Y4C1", "length": 1321, "sequence_sha256": "e7bf72cc6e68d88026fadbd8c3e128247c7aa74c5f7c5e686a647d5bc6fb3f50", "domains": [ { "domain_id": "UP:Q9Y4C1:PWWP1", "domain_name": "PWWP1", "start": 88, "end": 177, "source": "pfam via InterPro API", "membership_tier": "predicted_PWWP_like", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "Q9Y4C1:UPFEATURE:2", "type": "Zinc finger", "name": "C6-type", "start": 662, "end": 687, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9Y4C1.json", "evidence": [ { "evidenceCode": "ECO:0000255" } ], "source_index": 2 }, { "feature_id": "Q9Y4C1:UPFEATURE:1", "type": "Domain", "name": "JmjC", "start": 1058, "end": 1281, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9Y4C1.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00538" } ], "source_index": 1 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q9Y4C1", "source_url": "https://rest.uniprot.org/uniprotkb/Q9Y4C1.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q9Y4C1.json", "retrieved_utc": "2026-10-26T17:49:32.798800+00:00", "source_last_modified": null, "sha256": "7c2e92aa565cd62edff74b64734ed5bdbfd1773d54e6b88b60734a23f478edc7", "bytes": 44005, "entry_audit": { "firstPublicDate": "2005-11-22", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2010-10-05", "entryVersion": 187, "sequenceVersion": 4 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "e7bf72cc6e68d88026fadbd8c3e128247c7aa74c5f7c5e686a647d5bc6fb3f50", "source_sequence_sha256": "e7bf72cc6e68d88026fadbd8c3e128247c7aa74c5f7c5e686a647d5bc6fb3f50", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q7LBC6": { "uniprot": "Q7LBC6", "gene": "KDM3B", "protein_id": "UP:Q7LBC6", "length": 1761, "sequence_sha256": "1505989bd63442ce288dede6c43296c228dd9af466410ee7433eb4b25f0ffc22", "domains": [ { "domain_id": "UP:Q7LBC6:PWWP1", "domain_name": "PWWP1", "start": 90, "end": 188, "source": "pfam via InterPro API", "membership_tier": "predicted_PWWP_like", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "Q7LBC6:UPFEATURE:3", "type": "Zinc finger", "name": "C6-type", "start": 1031, "end": 1056, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q7LBC6.json", "evidence": [ { "evidenceCode": "ECO:0000255" } ], "source_index": 3 }, { "feature_id": "Q7LBC6:UPFEATURE:2", "type": "Domain", "name": "JmjC", "start": 1498, "end": 1721, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q7LBC6.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00538" } ], "source_index": 2 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q7LBC6", "source_url": "https://rest.uniprot.org/uniprotkb/Q7LBC6.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q7LBC6.json", "retrieved_utc": "2026-10-26T17:49:28.851214+00:00", "source_last_modified": null, "sha256": "62f480bc8c7ddf99d911b8f5a2c85942676abff5aa445dd40ee91117f989ca9d", "bytes": 68381, "entry_audit": { "firstPublicDate": "2006-05-16", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2010-10-05", "entryVersion": 166, "sequenceVersion": 2 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "1505989bd63442ce288dede6c43296c228dd9af466410ee7433eb4b25f0ffc22", "source_sequence_sha256": "1505989bd63442ce288dede6c43296c228dd9af466410ee7433eb4b25f0ffc22", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-Q7LBC6-2-F1:v6", "model_accession": "Q7LBC6-2", "protein_id": "UP:Q7LBC6", "sequence_length": 1417, "sequence_sha256": "2ef6a8c2446e13c04af148aba9f9888cc7e4d597e96d02896368ce5f85743813", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q7LBC6", "domain_id": "UP:Q7LBC6:PWWP1", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 99, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q7LBC6-2" }, { "model_record_id": "AF-Q7LBC6-3-F1:v6", "model_accession": "Q7LBC6-3", "protein_id": "UP:Q7LBC6", "sequence_length": 759, "sequence_sha256": "ca5f2998b6b41c263d025870d556b14c9e6c432eebaef8195cd1a12ba6fd9cb1", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q7LBC6", "domain_id": "UP:Q7LBC6:PWWP1", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 99, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q7LBC6-3" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q9P267": { "uniprot": "Q9P267", "gene": "MBD5", "protein_id": "UP:Q9P267", "length": 1494, "sequence_sha256": "7082f1aefa433f7e7d028c0537608ce756366f0c02408e6c7a938407e41aabe7", "domains": [ { "domain_id": "UP:Q9P267:PWWP1", "domain_name": "PWWP1", "start": 1385, "end": 1409, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "Q9P267:UPFEATURE:1", "type": "Domain", "name": "MBD", "start": 11, "end": 81, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9P267.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00338" } ], "source_index": 1 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q9P267", "source_url": "https://rest.uniprot.org/uniprotkb/Q9P267.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q9P267.json", "retrieved_utc": "2026-10-26T17:49:30.835492+00:00", "source_last_modified": null, "sha256": "cfebf2e2ba25005a807c3d1fa114d00cc95bfac198cb5ec8ccb26410d35b923e", "bytes": 42820, "entry_audit": { "firstPublicDate": "2004-07-19", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2010-05-18", "entryVersion": 181, "sequenceVersion": 3 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "7082f1aefa433f7e7d028c0537608ce756366f0c02408e6c7a938407e41aabe7", "source_sequence_sha256": "7082f1aefa433f7e7d028c0537608ce756366f0c02408e6c7a938407e41aabe7", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-Q9P267-2-F1:v6", "model_accession": "Q9P267-2", "protein_id": "UP:Q9P267", "sequence_length": 851, "sequence_sha256": "443901ac7c0e21ec4fb6a153c4b7f651d29149372ad38494dbacb59628017f0d", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9P267", "domain_id": "UP:Q9P267:PWWP1", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 25, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9P267-2" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "P52701": { "uniprot": "P52701", "gene": "MSH6", "protein_id": "UP:P52701", "length": 1360, "sequence_sha256": "30960d076a21b899791c2163483dd9bcfb7a839c13cd793c14148e914e948582", "domains": [ { "domain_id": "UP:P52701:PWWP1", "domain_name": "PWWP1", "start": 92, "end": 154, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "P52701", "source_url": "https://rest.uniprot.org/uniprotkb/P52701.json", "final_url": "https://rest.uniprot.org/uniprotkb/P52701.json", "retrieved_utc": "2026-10-26T17:49:25.893748+00:00", "source_last_modified": null, "sha256": "b2dfb8687b40c796ab5bca73b0062d6babe5407d0b5f832f1d5697d0f0717b18", "bytes": 152997, "entry_audit": { "firstPublicDate": "1996-10-01", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2005-06-21", "entryVersion": 261, "sequenceVersion": 2 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "30960d076a21b899791c2163483dd9bcfb7a839c13cd793c14148e914e948582", "source_sequence_sha256": "30960d076a21b899791c2163483dd9bcfb7a839c13cd793c14148e914e948582", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "6OQM", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 87, 198 ] ], "observed_ranges": [ [ 87, 186 ] ], "construct_length": 130, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 18 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:P52701:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 63, "annotation_core_length": 63 } ], "source_url": "https://www.rcsb.org/structure/6OQM", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "2GFU", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 68, 201 ] ], "observed_ranges": [ [ 68, 201 ] ], "construct_length": 134, "mapped_sequence_identity": 0.977612, "unmapped_construct_ranges": [], "sequence_mismatches": [ { "construct": "S", "entity_position": 21, "reference": "C", "uniprot_position": 88 }, { "construct": "S", "entity_position": 41, "reference": "C", "uniprot_position": 108 }, { "construct": "S", "entity_position": 129, "reference": "C", "uniprot_position": 196 } ], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:P52701:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 63, "annotation_core_length": 63 } ], "source_url": "https://www.rcsb.org/structure/2GFU", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-P52701-2-F1:v6", "model_accession": "P52701-2", "protein_id": "UP:P52701", "sequence_length": 1068, "sequence_sha256": "b950a495700fd3d5637748821d603905b201425f00f8185a0c3d3857e520345d", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/P52701", "domain_id": "UP:P52701:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 63, "domain_length": 63, "isoform_start": 92, "isoform_end": 154, "isoform_positions": [ 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/P52701-2" }, { "model_record_id": "AF-P52701-3-F1:v6", "model_accession": "P52701-3", "protein_id": "UP:P52701", "sequence_length": 1230, "sequence_sha256": "dae61a945bb46c6eb93456a657a3c4347121f18511f724a091b14e51df84014a", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/P52701", "domain_id": "UP:P52701:PWWP1", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 63, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/P52701-3" }, { "model_record_id": "AF-P52701-4-F1:v6", "model_accession": "P52701-4", "protein_id": "UP:P52701", "sequence_length": 1058, "sequence_sha256": "49e98dfd2b329e287739ad22cffa77ab37829758fa932a09e9a2fbd4aa581344", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/P52701", "domain_id": "UP:P52701:PWWP1", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 63, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/P52701-4" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q96L73": { "uniprot": "Q96L73", "gene": "NSD1", "protein_id": "UP:Q96L73", "length": 2696, "sequence_sha256": "3050432b8784dfca170c38859e360568bcd98b5bef9bbce391943fb70ad1c54a", "domains": [ { "domain_id": "UP:Q96L73:PWWP1", "domain_name": "PWWP1", "start": 323, "end": 388, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" }, { "domain_id": "UP:Q96L73:PWWP2", "domain_name": "PWWP2", "start": 1756, "end": 1818, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "Q96L73:UPFEATURE:6", "type": "Zinc finger", "name": "PHD-type 1", "start": 1543, "end": 1589, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q96L73.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00146" } ], "source_index": 6 }, { "feature_id": "Q96L73:UPFEATURE:7", "type": "Zinc finger", "name": "PHD-type 2", "start": 1590, "end": 1646, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q96L73.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00146" } ], "source_index": 7 }, { "feature_id": "Q96L73:UPFEATURE:8", "type": "Zinc finger", "name": "PHD-type 3", "start": 1707, "end": 1751, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q96L73.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00146" } ], "source_index": 8 }, { "feature_id": "Q96L73:UPFEATURE:3", "type": "Domain", "name": "AWS", "start": 1890, "end": 1940, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q96L73.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00562" } ], "source_index": 3 }, { "feature_id": "Q96L73:UPFEATURE:4", "type": "Domain", "name": "SET", "start": 1942, "end": 2059, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q96L73.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00190" } ], "source_index": 4 }, { "feature_id": "Q96L73:UPFEATURE:5", "type": "Domain", "name": "Post-SET", "start": 2066, "end": 2082, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q96L73.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00155" } ], "source_index": 5 }, { "feature_id": "Q96L73:UPFEATURE:9", "type": "Zinc finger", "name": "PHD-type 4; atypical", "start": 2118, "end": 2165, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q96L73.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00146" } ], "source_index": 9 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q96L73", "source_url": "https://rest.uniprot.org/uniprotkb/Q96L73.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q96L73.json", "retrieved_utc": "2026-10-26T17:49:30.005490+00:00", "source_last_modified": null, "sha256": "5c2340225cb3a571d04f5eae40e8ba09902f80af29ada3a4936c1a268f5ef827", "bytes": 86662, "entry_audit": { "firstPublicDate": "2003-07-03", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2001-12-01", "entryVersion": 217, "sequenceVersion": 1 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "3050432b8784dfca170c38859e360568bcd98b5bef9bbce391943fb70ad1c54a", "source_sequence_sha256": "3050432b8784dfca170c38859e360568bcd98b5bef9bbce391943fb70ad1c54a", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-Q96L73-2-F1:v6", "model_accession": "Q96L73-2", "protein_id": "UP:Q96L73", "sequence_length": 2427, "sequence_sha256": "a45226339ceb8ce7082b08ea3c322f22ff1c4005c00a7a1426dd84f28fd1e6a6", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q96L73", "domain_id": "UP:Q96L73:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 66, "domain_length": 66, "isoform_start": 54, "isoform_end": 119, "isoform_positions": [ 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q96L73-2" }, { "model_record_id": "AF-Q96L73-2-F1:v6", "model_accession": "Q96L73-2", "protein_id": "UP:Q96L73", "sequence_length": 2427, "sequence_sha256": "a45226339ceb8ce7082b08ea3c322f22ff1c4005c00a7a1426dd84f28fd1e6a6", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q96L73", "domain_id": "UP:Q96L73:PWWP2", "core_retention": "complete", "mapped_observed_core_residues": 63, "domain_length": 63, "isoform_start": 1487, "isoform_end": 1549, "isoform_positions": [ 1487, 1488, 1489, 1490, 1491, 1492, 1493, 1494, 1495, 1496, 1497, 1498, 1499, 1500, 1501, 1502, 1503, 1504, 1505, 1506, 1507, 1508, 1509, 1510, 1511, 1512, 1513, 1514, 1515, 1516, 1517, 1518, 1519, 1520, 1521, 1522, 1523, 1524, 1525, 1526, 1527, 1528, 1529, 1530, 1531, 1532, 1533, 1534, 1535, 1536, 1537, 1538, 1539, 1540, 1541, 1542, 1543, 1544, 1545, 1546, 1547, 1548, 1549 ], "domain_name": "PWWP2", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q96L73-2" }, { "model_record_id": "AF-Q96L73-3-F1:v6", "model_accession": "Q96L73-3", "protein_id": "UP:Q96L73", "sequence_length": 2593, "sequence_sha256": "80dcb7cc696a4122aab2714e2a14f42ef879fe01509f4810a748a5c88b72e81e", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q96L73", "domain_id": "UP:Q96L73:PWWP1", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 66, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q96L73-3" }, { "model_record_id": "AF-Q96L73-3-F1:v6", "model_accession": "Q96L73-3", "protein_id": "UP:Q96L73", "sequence_length": 2593, "sequence_sha256": "80dcb7cc696a4122aab2714e2a14f42ef879fe01509f4810a748a5c88b72e81e", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q96L73", "domain_id": "UP:Q96L73:PWWP2", "core_retention": "complete", "mapped_observed_core_residues": 63, "domain_length": 63, "isoform_start": 1653, "isoform_end": 1715, "isoform_positions": [ 1653, 1654, 1655, 1656, 1657, 1658, 1659, 1660, 1661, 1662, 1663, 1664, 1665, 1666, 1667, 1668, 1669, 1670, 1671, 1672, 1673, 1674, 1675, 1676, 1677, 1678, 1679, 1680, 1681, 1682, 1683, 1684, 1685, 1686, 1687, 1688, 1689, 1690, 1691, 1692, 1693, 1694, 1695, 1696, 1697, 1698, 1699, 1700, 1701, 1702, 1703, 1704, 1705, 1706, 1707, 1708, 1709, 1710, 1711, 1712, 1713, 1714, 1715 ], "domain_name": "PWWP2", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q96L73-3" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "O96028": { "uniprot": "O96028", "gene": "NSD2", "protein_id": "UP:O96028", "length": 1365, "sequence_sha256": "f6dcc93f9cc56631d70ae1a3534f6573cce6303fd5ed840e032480672c7964d6", "domains": [ { "domain_id": "UP:O96028:PWWP1", "domain_name": "PWWP1", "start": 222, "end": 286, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" }, { "domain_id": "UP:O96028:PWWP2", "domain_name": "PWWP2", "start": 880, "end": 942, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "O96028:UPFEATURE:7", "type": "Zinc finger", "name": "PHD-type 1", "start": 667, "end": 713, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/O96028.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00146" } ], "source_index": 7 }, { "feature_id": "O96028:UPFEATURE:8", "type": "Zinc finger", "name": "PHD-type 2", "start": 714, "end": 770, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/O96028.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00146" } ], "source_index": 8 }, { "feature_id": "O96028:UPFEATURE:9", "type": "Zinc finger", "name": "PHD-type 3", "start": 831, "end": 875, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/O96028.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00146" } ], "source_index": 9 }, { "feature_id": "O96028:UPFEATURE:3", "type": "Domain", "name": "AWS", "start": 1011, "end": 1061, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/O96028.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00562" } ], "source_index": 3 }, { "feature_id": "O96028:UPFEATURE:4", "type": "Domain", "name": "SET", "start": 1063, "end": 1180, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/O96028.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00190" } ], "source_index": 4 }, { "feature_id": "O96028:UPFEATURE:5", "type": "Domain", "name": "Post-SET", "start": 1187, "end": 1203, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/O96028.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00155" } ], "source_index": 5 }, { "feature_id": "O96028:UPFEATURE:10", "type": "Zinc finger", "name": "PHD-type 4; atypical", "start": 1239, "end": 1286, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/O96028.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00146" } ], "source_index": 10 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "O96028", "source_url": "https://rest.uniprot.org/uniprotkb/O96028.json", "final_url": "https://rest.uniprot.org/uniprotkb/O96028.json", "retrieved_utc": "2026-10-26T17:49:25.331230+00:00", "source_last_modified": null, "sha256": "06e61f3632b530e10f9662097a161cf44cb8152c70e993e00de1d5f0e0114dcb", "bytes": 119781, "entry_audit": { "firstPublicDate": "2006-10-31", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "1999-05-01", "entryVersion": 215, "sequenceVersion": 1 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "f6dcc93f9cc56631d70ae1a3534f6573cce6303fd5ed840e032480672c7964d6", "source_sequence_sha256": "f6dcc93f9cc56631d70ae1a3534f6573cce6303fd5ed840e032480672c7964d6", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "9FOC", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 208, 368 ] ], "observed_ranges": [ [ 215, 295 ], [ 315, 365 ] ], "construct_length": 176, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 4 ], [ 166, 176 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:O96028:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 65, "annotation_core_length": 65 } ], "source_url": "https://www.rcsb.org/structure/9FOC", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "5VC8", "chain": "B", "auth_chains": [ "B" ], "mapped_ranges": [ [ 211, 350 ] ], "observed_ranges": [ [ 217, 301 ], [ 310, 350 ] ], "construct_length": 141, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 1 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:O96028:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 65, "annotation_core_length": 65 } ], "source_url": "https://www.rcsb.org/structure/5VC8", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "9Y60", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 202, 368 ] ], "observed_ranges": [ [ 203, 368 ] ], "construct_length": 174, "mapped_sequence_identity": 0.994012, "unmapped_construct_ranges": [ [ 1, 1 ], [ 169, 174 ] ], "sequence_mismatches": [ { "construct": "A", "entity_position": 161, "reference": "K", "uniprot_position": 361 } ], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:O96028:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 65, "annotation_core_length": 65 } ], "source_url": "https://www.rcsb.org/structure/9Y60", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "29HG", "chain": "B", "auth_chains": [ "B" ], "mapped_ranges": [ [ 1, 1365 ] ], "observed_ranges": [ [ 212, 300 ], [ 316, 362 ] ], "construct_length": 1365, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [], "sequence_mismatches": [], "engineering_status": "no sequence difference detected by mapping; not proof of wild type", "coverage": [ { "domain_id": "UP:O96028:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 65, "annotation_core_length": 65 } ], "source_url": "https://www.rcsb.org/structure/29HG", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-O96028-2-F1:v6", "model_accession": "O96028-2", "protein_id": "UP:O96028", "sequence_length": 713, "sequence_sha256": "d6fefbdb8d317761708282efd1450e5804325f733a349aa298edb96459bfeaf6", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/O96028", "domain_id": "UP:O96028:PWWP1", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 65, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP1", "validated_edits": [ { "VSP_id": "VSP_021414", "canonical_start": 1, "canonical_end": 652, "kind": "deletion", "replacement_length": 0, "core_overlap_residues": 65, "replacement_sequence": "" }, { "VSP_id": "VSP_021423", "canonical_start": 653, "canonical_end": 712, "kind": "equal_length_replacement", "replacement_length": 60, "core_overlap_residues": 0, "replacement_sequence": "MAGSFCWRMLGLVSKVGNRARCFSSMAASEEELLDFSGSELQFNSCSLHLSLHPFFNFLL" } ], "correction_note": "Official deletion removes entire annotated core; incidental alignment matches cannot restore deleted residues.", "source_url": "https://www.uniprot.org/uniprotkb/O96028-2" }, { "model_record_id": "AF-O96028-2-F1:v6", "model_accession": "O96028-2", "protein_id": "UP:O96028", "sequence_length": 713, "sequence_sha256": "d6fefbdb8d317761708282efd1450e5804325f733a349aa298edb96459bfeaf6", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/O96028", "domain_id": "UP:O96028:PWWP2", "core_retention": "complete", "mapped_observed_core_residues": 63, "domain_length": 63, "isoform_start": 228, "isoform_end": 290, "isoform_positions": [ 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290 ], "domain_name": "PWWP2", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/O96028-2" }, { "model_record_id": "AF-O96028-3-F1:v6", "model_accession": "O96028-3", "protein_id": "UP:O96028", "sequence_length": 647, "sequence_sha256": "79360f602aa310d4f91f459b2c077462b24c99b8a23d2a8a981667b62d9b5c9d", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/O96028", "domain_id": "UP:O96028:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 65, "domain_length": 65, "isoform_start": 222, "isoform_end": 286, "isoform_positions": [ 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/O96028-3" }, { "model_record_id": "AF-O96028-3-F1:v6", "model_accession": "O96028-3", "protein_id": "UP:O96028", "sequence_length": 647, "sequence_sha256": "79360f602aa310d4f91f459b2c077462b24c99b8a23d2a8a981667b62d9b5c9d", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/O96028", "domain_id": "UP:O96028:PWWP2", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 63, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP2", "validated_edits": [ { "VSP_id": "VSP_021419", "canonical_start": 628, "canonical_end": 647, "kind": "equal_length_replacement", "replacement_length": 20, "core_overlap_residues": 0, "replacement_sequence": "LLWEPTPVKLDLNPAALYCT" }, { "VSP_id": "VSP_021422", "canonical_start": 648, "canonical_end": 1365, "kind": "deletion", "replacement_length": 0, "core_overlap_residues": 63, "replacement_sequence": "" } ], "correction_note": "Official deletion removes entire annotated core; incidental alignment matches cannot restore deleted residues.", "source_url": "https://www.uniprot.org/uniprotkb/O96028-3" }, { "model_record_id": "AF-O96028-4-F1:v6", "model_accession": "O96028-4", "protein_id": "UP:O96028", "sequence_length": 584, "sequence_sha256": "ea6733831caaba1a1e187a0f6d5817c8703b3ea268af26cbfa7589827ac4d626", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/O96028", "domain_id": "UP:O96028:PWWP1", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 65, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/O96028-4" }, { "model_record_id": "AF-O96028-4-F1:v6", "model_accession": "O96028-4", "protein_id": "UP:O96028", "sequence_length": 584, "sequence_sha256": "ea6733831caaba1a1e187a0f6d5817c8703b3ea268af26cbfa7589827ac4d626", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/O96028", "domain_id": "UP:O96028:PWWP2", "core_retention": "complete", "mapped_observed_core_residues": 63, "domain_length": 63, "isoform_start": 99, "isoform_end": 161, "isoform_positions": [ 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161 ], "domain_name": "PWWP2", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/O96028-4" }, { "model_record_id": "AF-O96028-5-F1:v6", "model_accession": "O96028-5", "protein_id": "UP:O96028", "sequence_length": 629, "sequence_sha256": "35fadedc0537a577878b7972ebeb76ab93a73a9386bc3b2ec94854723da1fac1", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/O96028", "domain_id": "UP:O96028:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 65, "domain_length": 65, "isoform_start": 222, "isoform_end": 286, "isoform_positions": [ 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/O96028-5" }, { "model_record_id": "AF-O96028-5-F1:v6", "model_accession": "O96028-5", "protein_id": "UP:O96028", "sequence_length": 629, "sequence_sha256": "35fadedc0537a577878b7972ebeb76ab93a73a9386bc3b2ec94854723da1fac1", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/O96028", "domain_id": "UP:O96028:PWWP2", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 63, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP2", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/O96028-5" }, { "model_record_id": "AF-O96028-6-F1:v6", "model_accession": "O96028-6", "protein_id": "UP:O96028", "sequence_length": 484, "sequence_sha256": "02baa5c6623f65b0e928b82d7886a66b87fa1582ee6e73481fd97a9d7bffb9d8", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/O96028", "domain_id": "UP:O96028:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 65, "domain_length": 65, "isoform_start": 222, "isoform_end": 286, "isoform_positions": [ 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/O96028-6" }, { "model_record_id": "AF-O96028-6-F1:v6", "model_accession": "O96028-6", "protein_id": "UP:O96028", "sequence_length": 484, "sequence_sha256": "02baa5c6623f65b0e928b82d7886a66b87fa1582ee6e73481fd97a9d7bffb9d8", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/O96028", "domain_id": "UP:O96028:PWWP2", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 63, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP2", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/O96028-6" }, { "model_record_id": "AF-O96028-7-F1:v6", "model_accession": "O96028-7", "protein_id": "UP:O96028", "sequence_length": 273, "sequence_sha256": "26f69270ea271a180062410898c22e7412d891c8090e5a516e10b18bd8b450b6", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/O96028", "domain_id": "UP:O96028:PWWP1", "core_retention": "partial", "mapped_observed_core_residues": 52, "domain_length": 65, "isoform_start": 222, "isoform_end": 273, "isoform_positions": [ 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273 ], "domain_name": "PWWP1", "validated_edits": [ { "VSP_id": "VSP_021415", "canonical_start": 255, "canonical_end": 273, "kind": "equal_length_replacement", "replacement_length": 19, "core_overlap_residues": 19, "replacement_sequence": "IFKSKKFEHLKTSQIVLKD" }, { "VSP_id": "VSP_021416", "canonical_start": 274, "canonical_end": 1365, "kind": "deletion", "replacement_length": 0, "core_overlap_residues": 13, "replacement_sequence": "" } ], "correction_note": "Use source-defined positions for equal-length replacement; replacement is not unchanged sequence.", "source_url": "https://www.uniprot.org/uniprotkb/O96028-7" }, { "model_record_id": "AF-O96028-7-F1:v6", "model_accession": "O96028-7", "protein_id": "UP:O96028", "sequence_length": 273, "sequence_sha256": "26f69270ea271a180062410898c22e7412d891c8090e5a516e10b18bd8b450b6", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/O96028", "domain_id": "UP:O96028:PWWP2", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 63, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP2", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/O96028-7" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q9BZ95": { "uniprot": "Q9BZ95", "gene": "NSD3", "protein_id": "UP:Q9BZ95", "length": 1437, "sequence_sha256": "1740a00df4b91dc186680dfedb4b8b1eaed2f508c951cb44f0a8a5995c52ba63", "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "domain_name": "PWWP1", "start": 270, "end": 333, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" }, { "domain_id": "UP:Q9BZ95:PWWP2", "domain_name": "PWWP2", "start": 960, "end": 1022, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "Q9BZ95:UPFEATURE:6", "type": "Zinc finger", "name": "PHD-type 1", "start": 701, "end": 748, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9BZ95.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00146" } ], "source_index": 6 }, { "feature_id": "Q9BZ95:UPFEATURE:7", "type": "Zinc finger", "name": "PHD-type 2", "start": 749, "end": 805, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9BZ95.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00146" } ], "source_index": 7 }, { "feature_id": "Q9BZ95:UPFEATURE:8", "type": "Zinc finger", "name": "PHD-type 3", "start": 862, "end": 955, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9BZ95.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00146" } ], "source_index": 8 }, { "feature_id": "Q9BZ95:UPFEATURE:3", "type": "Domain", "name": "AWS", "start": 1093, "end": 1143, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9BZ95.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00562" } ], "source_index": 3 }, { "feature_id": "Q9BZ95:UPFEATURE:4", "type": "Domain", "name": "SET", "start": 1145, "end": 1262, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9BZ95.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00190" } ], "source_index": 4 }, { "feature_id": "Q9BZ95:UPFEATURE:5", "type": "Domain", "name": "Post-SET", "start": 1269, "end": 1285, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9BZ95.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00155" } ], "source_index": 5 }, { "feature_id": "Q9BZ95:UPFEATURE:9", "type": "Zinc finger", "name": "PHD-type 4; atypical", "start": 1321, "end": 1368, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9BZ95.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00146" } ], "source_index": 9 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q9BZ95", "source_url": "https://rest.uniprot.org/uniprotkb/Q9BZ95.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q9BZ95.json", "retrieved_utc": "2026-10-26T17:49:30.858263+00:00", "source_last_modified": null, "sha256": "ebc5c07dcab9160e10772e84ab37f14597cf4f48080f7fc0b0203d6771b0b3a8", "bytes": 85979, "entry_audit": { "firstPublicDate": "2006-10-31", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2001-06-01", "entryVersion": 209, "sequenceVersion": 1 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "1740a00df4b91dc186680dfedb4b8b1eaed2f508c951cb44f0a8a5995c52ba63", "source_sequence_sha256": "1740a00df4b91dc186680dfedb4b8b1eaed2f508c951cb44f0a8a5995c52ba63", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "6G25", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 263, 398 ] ], "observed_ranges": [ [ 266, 343 ], [ 354, 396 ] ], "construct_length": 136, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [], "sequence_mismatches": [], "engineering_status": "no sequence difference detected by mapping; not proof of wild type", "coverage": [ { "domain_id": "UP:Q9BZ95:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 64, "annotation_core_length": 64 } ], "source_url": "https://www.rcsb.org/structure/6G25", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "4RXJ", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 953, 1064 ] ], "observed_ranges": [ [ 957, 1064 ] ], "construct_length": 113, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 1 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:Q9BZ95:PWWP2", "domain_name": "PWWP2", "observed_core_residues": 63, "annotation_core_length": 63 } ], "source_url": "https://www.rcsb.org/structure/4RXJ", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "2DAQ", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 957, 1053 ] ], "observed_ranges": [ [ 957, 1053 ] ], "construct_length": 110, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 7 ], [ 105, 110 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:Q9BZ95:PWWP2", "domain_name": "PWWP2", "observed_core_residues": 63, "annotation_core_length": 63 } ], "source_url": "https://www.rcsb.org/structure/2DAQ", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "6G3P", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 247, 398 ] ], "observed_ranges": [ [ 249, 256 ], [ 264, 343 ], [ 360, 395 ] ], "construct_length": 153, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 1 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:Q9BZ95:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 64, "annotation_core_length": 64 } ], "source_url": "https://www.rcsb.org/structure/6G3P", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-Q9BZ95-2-F1:v6", "model_accession": "Q9BZ95-2", "protein_id": "UP:Q9BZ95", "sequence_length": 1388, "sequence_sha256": "28253ecdec0a230c5c04da8a88b938d00c23f4088af11a1ec098bfd34d73fb52", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9BZ95", "domain_id": "UP:Q9BZ95:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 64, "domain_length": 64, "isoform_start": 270, "isoform_end": 333, "isoform_positions": [ 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9BZ95-2" }, { "model_record_id": "AF-Q9BZ95-2-F1:v6", "model_accession": "Q9BZ95-2", "protein_id": "UP:Q9BZ95", "sequence_length": 1388, "sequence_sha256": "28253ecdec0a230c5c04da8a88b938d00c23f4088af11a1ec098bfd34d73fb52", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9BZ95", "domain_id": "UP:Q9BZ95:PWWP2", "core_retention": "complete", "mapped_observed_core_residues": 63, "domain_length": 63, "isoform_start": 911, "isoform_end": 973, "isoform_positions": [ 911, 912, 913, 914, 915, 916, 917, 918, 919, 920, 921, 922, 923, 924, 925, 926, 927, 928, 929, 930, 931, 932, 933, 934, 935, 936, 937, 938, 939, 940, 941, 942, 943, 944, 945, 946, 947, 948, 949, 950, 951, 952, 953, 954, 955, 956, 957, 958, 959, 960, 961, 962, 963, 964, 965, 966, 967, 968, 969, 970, 971, 972, 973 ], "domain_name": "PWWP2", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9BZ95-2" }, { "model_record_id": "AF-Q9BZ95-3-F1:v6", "model_accession": "Q9BZ95-3", "protein_id": "UP:Q9BZ95", "sequence_length": 645, "sequence_sha256": "d7c457284cb34dc731eabfb54733e725976db9483abcfbcb77504c88faf586a5", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9BZ95", "domain_id": "UP:Q9BZ95:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 64, "domain_length": 64, "isoform_start": 270, "isoform_end": 333, "isoform_positions": [ 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9BZ95-3" }, { "model_record_id": "AF-Q9BZ95-3-F1:v6", "model_accession": "Q9BZ95-3", "protein_id": "UP:Q9BZ95", "sequence_length": 645, "sequence_sha256": "d7c457284cb34dc731eabfb54733e725976db9483abcfbcb77504c88faf586a5", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9BZ95", "domain_id": "UP:Q9BZ95:PWWP2", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 63, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP2", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9BZ95-3" }, { "model_record_id": "AF-Q9BZ95-4-F1:v6", "model_accession": "Q9BZ95-4", "protein_id": "UP:Q9BZ95", "sequence_length": 1374, "sequence_sha256": "53951b7e044d1998e9bc4702865d5244d02f8e2665dde9a5aa74d562ec90a006", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9BZ95", "domain_id": "UP:Q9BZ95:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 64, "domain_length": 64, "isoform_start": 207, "isoform_end": 270, "isoform_positions": [ 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9BZ95-4" }, { "model_record_id": "AF-Q9BZ95-4-F1:v6", "model_accession": "Q9BZ95-4", "protein_id": "UP:Q9BZ95", "sequence_length": 1374, "sequence_sha256": "53951b7e044d1998e9bc4702865d5244d02f8e2665dde9a5aa74d562ec90a006", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9BZ95", "domain_id": "UP:Q9BZ95:PWWP2", "core_retention": "complete", "mapped_observed_core_residues": 63, "domain_length": 63, "isoform_start": 897, "isoform_end": 959, "isoform_positions": [ 897, 898, 899, 900, 901, 902, 903, 904, 905, 906, 907, 908, 909, 910, 911, 912, 913, 914, 915, 916, 917, 918, 919, 920, 921, 922, 923, 924, 925, 926, 927, 928, 929, 930, 931, 932, 933, 934, 935, 936, 937, 938, 939, 940, 941, 942, 943, 944, 945, 946, 947, 948, 949, 950, 951, 952, 953, 954, 955, 956, 957, 958, 959 ], "domain_name": "PWWP2", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9BZ95-4" }, { "model_record_id": "AF-Q9BZ95-5-F1:v6", "model_accession": "Q9BZ95-5", "protein_id": "UP:Q9BZ95", "sequence_length": 1426, "sequence_sha256": "b69065aa8d89d4e3ee70c6f9a3db9afdd366951343266250730d2fec3c0a911c", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9BZ95", "domain_id": "UP:Q9BZ95:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 64, "domain_length": 64, "isoform_start": 270, "isoform_end": 333, "isoform_positions": [ 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9BZ95-5" }, { "model_record_id": "AF-Q9BZ95-5-F1:v6", "model_accession": "Q9BZ95-5", "protein_id": "UP:Q9BZ95", "sequence_length": 1426, "sequence_sha256": "b69065aa8d89d4e3ee70c6f9a3db9afdd366951343266250730d2fec3c0a911c", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9BZ95", "domain_id": "UP:Q9BZ95:PWWP2", "core_retention": "complete", "mapped_observed_core_residues": 63, "domain_length": 63, "isoform_start": 960, "isoform_end": 1022, "isoform_positions": [ 960, 961, 962, 963, 964, 965, 966, 967, 968, 969, 970, 971, 972, 973, 974, 975, 976, 977, 978, 979, 980, 981, 982, 983, 984, 985, 986, 987, 988, 989, 990, 991, 992, 993, 994, 995, 996, 997, 998, 999, 1000, 1001, 1002, 1003, 1004, 1005, 1006, 1007, 1008, 1009, 1010, 1011, 1012, 1013, 1014, 1015, 1016, 1017, 1018, 1019, 1020, 1021, 1022 ], "domain_name": "PWWP2", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9BZ95-5" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "O75475": { "uniprot": "O75475", "gene": "PSIP1", "protein_id": "UP:O75475", "length": 530, "sequence_sha256": "a0d8504fc2ce28870415fc343e3f9d05f8ab9b574fa9e28f0f89d5b6cbc2a563", "domains": [ { "domain_id": "UP:O75475:PWWP1", "domain_name": "PWWP1", "start": 1, "end": 64, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "O75475", "source_url": "https://rest.uniprot.org/uniprotkb/O75475.json", "final_url": "https://rest.uniprot.org/uniprotkb/O75475.json", "retrieved_utc": "2026-10-26T17:49:25.083850+00:00", "source_last_modified": null, "sha256": "dd0d32e145a90e9cb1c4d7c98bc725a3bd12e511ca81f5698e8fc80cfb52f50c", "bytes": 86910, "entry_audit": { "firstPublicDate": "2005-07-05", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "1998-11-01", "entryVersion": 214, "sequenceVersion": 1 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "a0d8504fc2ce28870415fc343e3f9d05f8ab9b574fa9e28f0f89d5b6cbc2a563", "source_sequence_sha256": "a0d8504fc2ce28870415fc343e3f9d05f8ab9b574fa9e28f0f89d5b6cbc2a563", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "2M16", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 1, 93 ] ], "observed_ranges": [ [ 1, 93 ] ], "construct_length": 97, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 4 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:O75475:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 64, "annotation_core_length": 64 } ], "source_url": "https://www.rcsb.org/structure/2M16", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "9S83", "chain": "B", "auth_chains": [ "B" ], "mapped_ranges": [ [ 1, 90 ] ], "observed_ranges": [ [ 2, 90 ] ], "construct_length": 91, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 1 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:O75475:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 63, "annotation_core_length": 64 } ], "source_url": "https://www.rcsb.org/structure/9S83", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "3ZEH", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 3, 100 ] ], "observed_ranges": [ [ 3, 93 ] ], "construct_length": 105, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 7 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:O75475:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 62, "annotation_core_length": 64 } ], "source_url": "https://www.rcsb.org/structure/3ZEH", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "4FU6", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 1, 135 ] ], "observed_ranges": [ [ 1, 30 ], [ 33, 91 ] ], "construct_length": 153, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 18 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:O75475:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 62, "annotation_core_length": 64 } ], "source_url": "https://www.rcsb.org/structure/4FU6", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-O75475-2-F1:v6", "model_accession": "O75475-2", "protein_id": "UP:O75475", "sequence_length": 333, "sequence_sha256": "339f6160376733a71a74fcae4b62a803adecb417813bbdf1f151385aa62ad273", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/O75475", "domain_id": "UP:O75475:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 64, "domain_length": 64, "isoform_start": 1, "isoform_end": 64, "isoform_positions": [ 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/O75475-2" }, { "model_record_id": "AF-O75475-3-F1:v6", "model_accession": "O75475-3", "protein_id": "UP:O75475", "sequence_length": 329, "sequence_sha256": "b1882495896a2ab9eabb3054c5b9adf661e15c4370d9b0ed884fdc84dfa04d91", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/O75475", "domain_id": "UP:O75475:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 64, "domain_length": 64, "isoform_start": 1, "isoform_end": 64, "isoform_positions": [ 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/O75475-3" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q96N64": { "uniprot": "Q96N64", "gene": "PWWP2A", "protein_id": "UP:Q96N64", "length": 755, "sequence_sha256": "4878e4a941f8d9e59b72fc7540b888118798462cc8e853c3b4747c0fbec2db95", "domains": [ { "domain_id": "UP:Q96N64:PWWP1", "domain_name": "PWWP1", "start": 655, "end": 715, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q96N64", "source_url": "https://rest.uniprot.org/uniprotkb/Q96N64.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q96N64.json", "retrieved_utc": "2026-10-26T17:49:29.998509+00:00", "source_last_modified": null, "sha256": "5f010b2543d3a3a48c174ff6c2a587dd0976b51eff8d32f332e496ad17b00159", "bytes": 42192, "entry_audit": { "firstPublicDate": "2007-11-13", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2007-11-13", "entryVersion": 158, "sequenceVersion": 2 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "4878e4a941f8d9e59b72fc7540b888118798462cc8e853c3b4747c0fbec2db95", "source_sequence_sha256": "4878e4a941f8d9e59b72fc7540b888118798462cc8e853c3b4747c0fbec2db95", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-Q96N64-2-F1:v6", "model_accession": "Q96N64-2", "protein_id": "UP:Q96N64", "sequence_length": 560, "sequence_sha256": "9e555875e1376cc7a393710ce148b95f9da1203784c81865335c1930df1bfc0d", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q96N64", "domain_id": "UP:Q96N64:PWWP1", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 61, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP1", "validated_edits": [ { "VSP_id": "VSP_029547", "canonical_start": 518, "canonical_end": 560, "kind": "equal_length_replacement", "replacement_length": 43, "core_overlap_residues": 0, "replacement_sequence": "LNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKRAAQRH" }, { "VSP_id": "VSP_029548", "canonical_start": 561, "canonical_end": 755, "kind": "deletion", "replacement_length": 0, "core_overlap_residues": 61, "replacement_sequence": "" } ], "correction_note": "Official deletion removes entire annotated core; incidental alignment matches cannot restore deleted residues.", "source_url": "https://www.uniprot.org/uniprotkb/Q96N64-2" }, { "model_record_id": "AF-Q96N64-3-F1:v6", "model_accession": "Q96N64-3", "protein_id": "UP:Q96N64", "sequence_length": 520, "sequence_sha256": "f5de610817f06a2f2fe23217034e64f70584609bdbe7371620f2c82ca4a6b6c3", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q96N64", "domain_id": "UP:Q96N64:PWWP1", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 61, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q96N64-3" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q6NUJ5": { "uniprot": "Q6NUJ5", "gene": "PWWP2B", "protein_id": "UP:Q6NUJ5", "length": 590, "sequence_sha256": "9e13941725384cf76a672388d2405bbe3f7a7688a40a06f24035577cd8248188", "domains": [ { "domain_id": "UP:Q6NUJ5:PWWP1", "domain_name": "PWWP1", "start": 490, "end": 550, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q6NUJ5", "source_url": "https://rest.uniprot.org/uniprotkb/Q6NUJ5.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q6NUJ5.json", "retrieved_utc": "2026-10-26T17:49:28.819693+00:00", "source_last_modified": null, "sha256": "e28c36ed8ee3d57426829d196bf7bd75c3c89ee311897beca318b11a7a881156", "bytes": 30353, "entry_audit": { "firstPublicDate": "2006-06-27", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2007-11-13", "entryVersion": 164, "sequenceVersion": 3 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "9e13941725384cf76a672388d2405bbe3f7a7688a40a06f24035577cd8248188", "source_sequence_sha256": "9e13941725384cf76a672388d2405bbe3f7a7688a40a06f24035577cd8248188", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "4LD6", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 475, 590 ] ], "observed_ranges": [ [ 475, 590 ] ], "construct_length": 117, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 1 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:Q6NUJ5:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 61, "annotation_core_length": 61 } ], "source_url": "https://www.rcsb.org/structure/4LD6", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-Q6NUJ5-2-F1:v6", "model_accession": "Q6NUJ5-2", "protein_id": "UP:Q6NUJ5", "sequence_length": 499, "sequence_sha256": "562c38ec6ef94d56196cbd08328bfd18a98a767285b346560bfd653d8ff2480e", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q6NUJ5", "domain_id": "UP:Q6NUJ5:PWWP1", "core_retention": "partial", "mapped_observed_core_residues": 10, "domain_length": 61, "isoform_start": 490, "isoform_end": 499, "isoform_positions": [ 490, 491, 492, 493, 494, 495, 496, 497, 498, 499 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q6NUJ5-2" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q2TAK8": { "uniprot": "Q2TAK8", "gene": "PWWP3A", "protein_id": "UP:Q2TAK8", "length": 710, "sequence_sha256": "cae3f40bf1fdd386be7c7b5a262842bdb8c7c5c79fe1f733fd229e4531bcad08", "domains": [ { "domain_id": "UP:Q2TAK8:PWWP1", "domain_name": "PWWP1", "start": 411, "end": 472, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q2TAK8", "source_url": "https://rest.uniprot.org/uniprotkb/Q2TAK8.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q2TAK8.json", "retrieved_utc": "2026-10-26T17:49:26.860494+00:00", "source_last_modified": null, "sha256": "19878db97f43966e50ea9b475b1ae8a3b81e671885587faf798abf2c81a16319", "bytes": 33529, "entry_audit": { "firstPublicDate": "2007-07-10", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2009-09-22", "entryVersion": 147, "sequenceVersion": 3 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "cae3f40bf1fdd386be7c7b5a262842bdb8c7c5c79fe1f733fd229e4531bcad08", "source_sequence_sha256": "cae3f40bf1fdd386be7c7b5a262842bdb8c7c5c79fe1f733fd229e4531bcad08", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "3PMI", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 405, 538 ] ], "observed_ranges": [ [ 408, 529 ] ], "construct_length": 134, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [], "sequence_mismatches": [], "engineering_status": "no sequence difference detected by mapping; not proof of wild type", "coverage": [ { "domain_id": "UP:Q2TAK8:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 62, "annotation_core_length": 62 } ], "source_url": "https://www.rcsb.org/structure/3PMI", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-Q2TAK8-2-F1:v6", "model_accession": "Q2TAK8-2", "protein_id": "UP:Q2TAK8", "sequence_length": 642, "sequence_sha256": "f9efc44ceb2042b612e4417966b8e357d88a0b2223b27cb9a684cc0f1f9e9310", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q2TAK8", "domain_id": "UP:Q2TAK8:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 62, "domain_length": 62, "isoform_start": 343, "isoform_end": 404, "isoform_positions": [ 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q2TAK8-2" }, { "model_record_id": "AF-Q2TAK8-3-F1:v6", "model_accession": "Q2TAK8-3", "protein_id": "UP:Q2TAK8", "sequence_length": 731, "sequence_sha256": "311df762bd0fd6d419b7cb01d16f49cfe2cf8e5841833824f24fe6943267efd6", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q2TAK8", "domain_id": "UP:Q2TAK8:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 62, "domain_length": 62, "isoform_start": 411, "isoform_end": 472, "isoform_positions": [ 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466, 467, 468, 469, 470, 471, 472 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q2TAK8-3" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q5H9M0": { "uniprot": "Q5H9M0", "gene": "PWWP3B", "protein_id": "UP:Q5H9M0", "length": 696, "sequence_sha256": "f52854178f23eb89309cf05b4933b19e67eaddb3a859f67a38c03dff74dff241", "domains": [ { "domain_id": "UP:Q5H9M0:PWWP1", "domain_name": "PWWP1", "start": 392, "end": 453, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q5H9M0", "source_url": "https://rest.uniprot.org/uniprotkb/Q5H9M0.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q5H9M0.json", "retrieved_utc": "2026-10-26T17:49:27.819098+00:00", "source_last_modified": null, "sha256": "a9a6cad31519411c3d5171a16920ae00fd33479b83c167de98ed4c1a5141f14e", "bytes": 27317, "entry_audit": { "firstPublicDate": "2006-10-31", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2005-02-15", "entryVersion": 133, "sequenceVersion": 1 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "f52854178f23eb89309cf05b4933b19e67eaddb3a859f67a38c03dff74dff241", "source_sequence_sha256": "f52854178f23eb89309cf05b4933b19e67eaddb3a859f67a38c03dff74dff241", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "A0A494C071": { "uniprot": "A0A494C071", "gene": "PWWP4", "protein_id": "UP:A0A494C071", "length": 2061, "sequence_sha256": "78873f61404cc77c8de23d6d0564aca068a2e3c4d275c61e3600fd48e4d4d507", "domains": [ { "domain_id": "UP:A0A494C071:PWWP1", "domain_name": "PWWP1", "start": 1756, "end": 1817, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "A0A494C071", "source_url": "https://rest.uniprot.org/uniprotkb/A0A494C071.json", "final_url": "https://rest.uniprot.org/uniprotkb/A0A494C071.json", "retrieved_utc": "2026-10-26T17:49:24.774887+00:00", "source_last_modified": null, "sha256": "40311150e1c8e8e90f1a9d77c1ad6e3058d4fa51e8e34b49a4bbe47c68e3063b", "bytes": 16856, "entry_audit": { "firstPublicDate": "2023-02-22", "lastAnnotationUpdateDate": "2026-06-10", "lastSequenceUpdateDate": "2019-06-05", "entryVersion": 24, "sequenceVersion": 1 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "78873f61404cc77c8de23d6d0564aca068a2e3c4d275c61e3600fd48e4d4d507", "source_sequence_sha256": "78873f61404cc77c8de23d6d0564aca068a2e3c4d275c61e3600fd48e4d4d507", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q9H0M4": { "uniprot": "Q9H0M4", "gene": "ZCWPW1", "protein_id": "UP:Q9H0M4", "length": 648, "sequence_sha256": "176640f1e67aba064bee41cac0bb38abed71c22115ecb753fbe5afcfe62fedf6", "domains": [ { "domain_id": "UP:Q9H0M4:PWWP1", "domain_name": "PWWP1", "start": 317, "end": 383, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "Q9H0M4:UPFEATURE:2", "type": "Zinc finger", "name": "CW-type", "start": 250, "end": 304, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9H0M4.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00454" }, { "evidenceCode": "ECO:0000269", "source": "PubMed", "id": "20826339" } ], "source_index": 2 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q9H0M4", "source_url": "https://rest.uniprot.org/uniprotkb/Q9H0M4.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q9H0M4.json", "retrieved_utc": "2026-10-26T17:49:30.848422+00:00", "source_last_modified": null, "sha256": "21f1dcd09636f966d36ff18e9425e2841f6240c10f398cd46cf212f94cd41a7c", "bytes": 40479, "entry_audit": { "firstPublicDate": "2004-08-31", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2008-10-14", "entryVersion": 177, "sequenceVersion": 2 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "176640f1e67aba064bee41cac0bb38abed71c22115ecb753fbe5afcfe62fedf6", "source_sequence_sha256": "176640f1e67aba064bee41cac0bb38abed71c22115ecb753fbe5afcfe62fedf6", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-Q9H0M4-2-F1:v6", "model_accession": "Q9H0M4-2", "protein_id": "UP:Q9H0M4", "sequence_length": 468, "sequence_sha256": "8f18439dcce77c834ba48232fdf00cf13a84bc5d4f1757e358fcb61567e2e730", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9H0M4", "domain_id": "UP:Q9H0M4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 67, "domain_length": 67, "isoform_start": 319, "isoform_end": 385, "isoform_positions": [ 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9H0M4-2" }, { "model_record_id": "AF-Q9H0M4-3-F1:v6", "model_accession": "Q9H0M4-3", "protein_id": "UP:Q9H0M4", "sequence_length": 403, "sequence_sha256": "c72131dfb2348a98572f837e21ed67ec854ec3da48c40abe935ed9ef2738839e", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9H0M4", "domain_id": "UP:Q9H0M4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 67, "domain_length": 67, "isoform_start": 197, "isoform_end": 263, "isoform_positions": [ 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9H0M4-3" }, { "model_record_id": "AF-Q9H0M4-4-F1:v6", "model_accession": "Q9H0M4-4", "protein_id": "UP:Q9H0M4", "sequence_length": 477, "sequence_sha256": "4eb45603c39bccecd5eb56084acbaa78f8a1db8e93d8f36a9955c307e8bc3631", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9H0M4", "domain_id": "UP:Q9H0M4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 67, "domain_length": 67, "isoform_start": 197, "isoform_end": 263, "isoform_positions": [ 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9H0M4-4" }, { "model_record_id": "AF-Q9H0M4-5-F1:v6", "model_accession": "Q9H0M4-5", "protein_id": "UP:Q9H0M4", "sequence_length": 524, "sequence_sha256": "7a3fbfae192851151f4c5662ea0c7b62792112ad01a5bfacbf979e7a4c945aa2", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9H0M4", "domain_id": "UP:Q9H0M4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 67, "domain_length": 67, "isoform_start": 318, "isoform_end": 384, "isoform_positions": [ 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9H0M4-5" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q504Y3": { "uniprot": "Q504Y3", "gene": "ZCWPW2", "protein_id": "UP:Q504Y3", "length": 356, "sequence_sha256": "bb4217d9dac35cd8e8bbabc7d9b003e0e2a1765483f348043d357fb678350170", "domains": [ { "domain_id": "UP:Q504Y3:PWWP1", "domain_name": "PWWP1", "start": 98, "end": 162, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "Q504Y3:UPFEATURE:2", "type": "Zinc finger", "name": "CW-type", "start": 24, "end": 79, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q504Y3.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00454" } ], "source_index": 2 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q504Y3", "source_url": "https://rest.uniprot.org/uniprotkb/Q504Y3.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q504Y3.json", "retrieved_utc": "2026-10-26T17:49:27.804433+00:00", "source_last_modified": null, "sha256": "feef4183fa62aa455d8c88f9738d46930f04d349d47defd7895a792eee3b56d8", "bytes": 18960, "entry_audit": { "firstPublicDate": "2007-05-01", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2005-06-07", "entryVersion": 130, "sequenceVersion": 1 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "bb4217d9dac35cd8e8bbabc7d9b003e0e2a1765483f348043d357fb678350170", "source_sequence_sha256": "bb4217d9dac35cd8e8bbabc7d9b003e0e2a1765483f348043d357fb678350170", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q15326": { "uniprot": "Q15326", "gene": "ZMYND11", "protein_id": "UP:Q15326", "length": 602, "sequence_sha256": "4f71fe9fa61d92e0484c473ff33260468516561b2dc2737da457d7ec2b33c830", "domains": [ { "domain_id": "UP:Q15326:PWWP1", "domain_name": "PWWP1", "start": 280, "end": 331, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "Q15326:UPFEATURE:1", "type": "Domain", "name": "SAMD1-like winged helix (WH)", "start": 6, "end": 82, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q15326.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU01358" } ], "source_index": 1 }, { "feature_id": "Q15326:UPFEATURE:4", "type": "Zinc finger", "name": "PHD-type", "start": 100, "end": 148, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q15326.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00146" } ], "source_index": 4 }, { "feature_id": "Q15326:UPFEATURE:2", "type": "Domain", "name": "Bromo", "start": 149, "end": 255, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q15326.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00035" } ], "source_index": 2 }, { "feature_id": "Q15326:UPFEATURE:5", "type": "Zinc finger", "name": "MYND-type", "start": 563, "end": 598, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q15326.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00134" }, { "evidenceCode": "ECO:0000269", "source": "PubMed", "id": "26845565" } ], "source_index": 5 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q15326", "source_url": "https://rest.uniprot.org/uniprotkb/Q15326.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q15326.json", "retrieved_utc": "2026-10-26T17:49:26.927624+00:00", "source_last_modified": null, "sha256": "f3ac62f538dbcb9e7808a9643373be34d63b358874baedcd4c070b3970711901", "bytes": 87532, "entry_audit": { "firstPublicDate": "2000-12-01", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2012-11-28", "entryVersion": 212, "sequenceVersion": 2 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "4f71fe9fa61d92e0484c473ff33260468516561b2dc2737da457d7ec2b33c830", "source_sequence_sha256": "4f71fe9fa61d92e0484c473ff33260468516561b2dc2737da457d7ec2b33c830", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "4NS5", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 154, 371 ] ], "observed_ranges": [ [ 156, 171 ], [ 196, 364 ] ], "construct_length": 227, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 1 ], [ 220, 227 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:Q15326:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 52, "annotation_core_length": 52 } ], "source_url": "https://www.rcsb.org/structure/4NS5", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-Q15326-2-F1:v6", "model_accession": "Q15326-2", "protein_id": "UP:Q15326", "sequence_length": 548, "sequence_sha256": "8901ce77ada9825dc69aaee76dcfeaf0164caf482627d10953786a4cf2652456", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q15326", "domain_id": "UP:Q15326:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 52, "domain_length": 52, "isoform_start": 226, "isoform_end": 277, "isoform_positions": [ 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q15326-2" }, { "model_record_id": "AF-Q15326-3-F1:v6", "model_accession": "Q15326-3", "protein_id": "UP:Q15326", "sequence_length": 568, "sequence_sha256": "009741a7b276eb326c39994fd8b792dc8bd603bb186261185c0788b19aa69dc3", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q15326", "domain_id": "UP:Q15326:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 52, "domain_length": 52, "isoform_start": 280, "isoform_end": 331, "isoform_positions": [ 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q15326-3" }, { "model_record_id": "AF-Q15326-4-F1:v6", "model_accession": "Q15326-4", "protein_id": "UP:Q15326", "sequence_length": 514, "sequence_sha256": "35a66f3ba69f6e12ac18df596e99b15698e770010a3d67eb60d1f440a4bbfbd3", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q15326", "domain_id": "UP:Q15326:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 52, "domain_length": 52, "isoform_start": 226, "isoform_end": 277, "isoform_positions": [ 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q15326-4" }, { "model_record_id": "AF-Q15326-5-F1:v6", "model_accession": "Q15326-5", "protein_id": "UP:Q15326", "sequence_length": 517, "sequence_sha256": "de2e909af0d2128797836359fac08fdaec5d3787f3f939d1d6222d23cda6bb7c", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q15326", "domain_id": "UP:Q15326:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 52, "domain_length": 52, "isoform_start": 195, "isoform_end": 246, "isoform_positions": [ 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q15326-5" }, { "model_record_id": "AF-Q15326-6-F1:v6", "model_accession": "Q15326-6", "protein_id": "UP:Q15326", "sequence_length": 567, "sequence_sha256": "b5664a84e7d17b0be11a84568426c1672f621b24485cd3d00f89670b99dc6da2", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q15326", "domain_id": "UP:Q15326:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 52, "domain_length": 52, "isoform_start": 279, "isoform_end": 330, "isoform_positions": [ 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q15326-6" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q9ULU4": { "uniprot": "Q9ULU4", "gene": "ZMYND8", "protein_id": "UP:Q9ULU4", "length": 1186, "sequence_sha256": "78c6bdb417ce3dc0658b9f79fd5c5f351c2e72fa2c7bd259125eabf50dffd884", "domains": [ { "domain_id": "UP:Q9ULU4:PWWP1", "domain_name": "PWWP1", "start": 277, "end": 327, "source": "UniProtKB reviewed feature", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "Q9ULU4:UPFEATURE:3", "type": "Zinc finger", "name": "PHD-type", "start": 88, "end": 133, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9ULU4.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00146" } ], "source_index": 3 }, { "feature_id": "Q9ULU4:UPFEATURE:1", "type": "Domain", "name": "Bromo", "start": 145, "end": 252, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9ULU4.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00035" } ], "source_index": 1 }, { "feature_id": "Q9ULU4:UPFEATURE:4", "type": "Zinc finger", "name": "MYND-type", "start": 1028, "end": 1062, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q9ULU4.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00134" } ], "source_index": 4 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q9ULU4", "source_url": "https://rest.uniprot.org/uniprotkb/Q9ULU4.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q9ULU4.json", "retrieved_utc": "2026-10-26T17:49:32.169350+00:00", "source_last_modified": null, "sha256": "4c8abb1730a39d3a335f86402512f842ce425ad84106077058fb86e34f1b2823", "bytes": 139137, "entry_audit": { "firstPublicDate": "2002-11-25", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2002-11-25", "entryVersion": 221, "sequenceVersion": 2 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "78c6bdb417ce3dc0658b9f79fd5c5f351c2e72fa2c7bd259125eabf50dffd884", "source_sequence_sha256": "78c6bdb417ce3dc0658b9f79fd5c5f351c2e72fa2c7bd259125eabf50dffd884", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "9T2G", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 83, 406 ] ], "observed_ranges": [ [ 86, 117 ], [ 124, 399 ] ], "construct_length": 326, "mapped_sequence_identity": 0.993827, "unmapped_construct_ranges": [ [ 1, 2 ] ], "sequence_mismatches": [ { "construct": "R", "entity_position": 121, "reference": "N", "uniprot_position": 201 }, { "construct": "H", "entity_position": 126, "reference": "M", "uniprot_position": 206 } ], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:Q9ULU4:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 51, "annotation_core_length": 51 } ], "source_url": "https://www.rcsb.org/structure/9T2G", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." }, { "pdb_id": "5B73", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 73, 406 ] ], "observed_ranges": [ [ 86, 396 ], [ 402, 403 ] ], "construct_length": 339, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 5 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:Q9ULU4:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 51, "annotation_core_length": 51 } ], "source_url": "https://www.rcsb.org/structure/5B73", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [ { "model_record_id": "AF-Q9ULU4-10-F1:v6", "model_accession": "Q9ULU4-10", "protein_id": "UP:Q9ULU4", "sequence_length": 1206, "sequence_sha256": "aa7c5ae6780b24db089eb74fa45c3204a0373a107bfec7e60378438e058fa91a", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 297, "isoform_end": 347, "isoform_positions": [ 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-10" }, { "model_record_id": "AF-Q9ULU4-11-F1:v6", "model_accession": "Q9ULU4-11", "protein_id": "UP:Q9ULU4", "sequence_length": 1214, "sequence_sha256": "16fd71ddc9e4345c720df9f11465e51b0fb51732df70bf36123a7a07988d38d3", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 277, "isoform_end": 327, "isoform_positions": [ 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-11" }, { "model_record_id": "AF-Q9ULU4-12-F1:v6", "model_accession": "Q9ULU4-12", "protein_id": "UP:Q9ULU4", "sequence_length": 1160, "sequence_sha256": "ade39d2985cdfcc45481ef8606b9e38bbe45abc8fa38347e128aa8613982eaee", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 297, "isoform_end": 347, "isoform_positions": [ 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-12" }, { "model_record_id": "AF-Q9ULU4-13-F1:v6", "model_accession": "Q9ULU4-13", "protein_id": "UP:Q9ULU4", "sequence_length": 1188, "sequence_sha256": "96164bf79260672f09592d4ee1908455babc35cb49d14c45d79e4b12a3d4f1c0", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 297, "isoform_end": 347, "isoform_positions": [ 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-13" }, { "model_record_id": "AF-Q9ULU4-14-F1:v6", "model_accession": "Q9ULU4-14", "protein_id": "UP:Q9ULU4", "sequence_length": 1135, "sequence_sha256": "b478db009908551964cdb15745e3ab40d51d5a3ab823de3fe8d7baa0effe9c47", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 272, "isoform_end": 322, "isoform_positions": [ 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-14" }, { "model_record_id": "AF-Q9ULU4-15-F1:v6", "model_accession": "Q9ULU4-15", "protein_id": "UP:Q9ULU4", "sequence_length": 1088, "sequence_sha256": "0197ff972d5923eca0d8adc01ea5c04103c974eaab7ab73520ebf01c66c0fff1", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 272, "isoform_end": 322, "isoform_positions": [ 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-15" }, { "model_record_id": "AF-Q9ULU4-16-F1:v6", "model_accession": "Q9ULU4-16", "protein_id": "UP:Q9ULU4", "sequence_length": 1163, "sequence_sha256": "70081a402703e381449c4607530b01798ddd2c1b3375c78965d037a891fa0cb8", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 272, "isoform_end": 322, "isoform_positions": [ 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-16" }, { "model_record_id": "AF-Q9ULU4-17-F1:v6", "model_accession": "Q9ULU4-17", "protein_id": "UP:Q9ULU4", "sequence_length": 1054, "sequence_sha256": "e49daf98328d9d93dea027815f835ab1aa0b9da57fe37522c47b75a1846ec35d", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 272, "isoform_end": 322, "isoform_positions": [ 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-17" }, { "model_record_id": "AF-Q9ULU4-18-F1:v6", "model_accession": "Q9ULU4-18", "protein_id": "UP:Q9ULU4", "sequence_length": 1134, "sequence_sha256": "949db4df01d74a7aeb7ccccccc3ba522d81226912c3dee387404c000c45fa3b4", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 272, "isoform_end": 322, "isoform_positions": [ 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-18" }, { "model_record_id": "AF-Q9ULU4-19-F1:v6", "model_accession": "Q9ULU4-19", "protein_id": "UP:Q9ULU4", "sequence_length": 1241, "sequence_sha256": "8a34f2e528705ddd7ac25101ca3829d8eb933f6a3fcfa271175f6150a4a51fad", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 304, "isoform_end": 354, "isoform_positions": [ 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-19" }, { "model_record_id": "AF-Q9ULU4-2-F1:v6", "model_accession": "Q9ULU4-2", "protein_id": "UP:Q9ULU4", "sequence_length": 614, "sequence_sha256": "b2cebe36e715a887a33c8b328f32145a7b4918d24f0d5b027a22a99158278e79", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 51, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-2" }, { "model_record_id": "AF-Q9ULU4-20-F1:v6", "model_accession": "Q9ULU4-20", "protein_id": "UP:Q9ULU4", "sequence_length": 1186, "sequence_sha256": "f5ecdee2fdd17fd428b5a59f7ad54910012caf8f07a41d19eacb38b20b5fec5e", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 277, "isoform_end": 327, "isoform_positions": [ 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-20" }, { "model_record_id": "AF-Q9ULU4-21-F1:v6", "model_accession": "Q9ULU4-21", "protein_id": "UP:Q9ULU4", "sequence_length": 1115, "sequence_sha256": "14c77aa12de8880474fe3bf44afae72b8df5a882daa48f2bb789d7818effd437", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 252, "isoform_end": 302, "isoform_positions": [ 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-21" }, { "model_record_id": "AF-Q9ULU4-22-F1:v6", "model_accession": "Q9ULU4-22", "protein_id": "UP:Q9ULU4", "sequence_length": 1161, "sequence_sha256": "6a8902b7ad0cf3a8417c3ea9940b8a3b3aefd4233c4056ba9d326c615e0af2fc", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 297, "isoform_end": 347, "isoform_positions": [ 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-22" }, { "model_record_id": "AF-Q9ULU4-23-F1:v6", "model_accession": "Q9ULU4-23", "protein_id": "UP:Q9ULU4", "sequence_length": 1105, "sequence_sha256": "c1ca7b4493ebba677966f463e3ec0f18077a9c4efa8707d0b453d1a0e5f3ac75", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 214, "isoform_end": 264, "isoform_positions": [ 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-23" }, { "model_record_id": "AF-Q9ULU4-3-F1:v6", "model_accession": "Q9ULU4-3", "protein_id": "UP:Q9ULU4", "sequence_length": 995, "sequence_sha256": "9dd7dc8164376a94c151e3e45838a685e41443ee10e15bfd1fb0e7b21bc88e62", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 132, "isoform_end": 182, "isoform_positions": [ 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-3" }, { "model_record_id": "AF-Q9ULU4-4-F1:v6", "model_accession": "Q9ULU4-4", "protein_id": "UP:Q9ULU4", "sequence_length": 764, "sequence_sha256": "d8f1ffae34e824d7af8b0cc9985b2f63138c4ec75913ef3b612906f917483f4f", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "absent", "mapped_observed_core_residues": 0, "domain_length": 51, "isoform_start": null, "isoform_end": null, "isoform_positions": [], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-4" }, { "model_record_id": "AF-Q9ULU4-5-F1:v6", "model_accession": "Q9ULU4-5", "protein_id": "UP:Q9ULU4", "sequence_length": 1181, "sequence_sha256": "0ee472f9ab3e8a85bbd634822d8b403c34cbb953834514887e6bc448d79787ab", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 272, "isoform_end": 322, "isoform_positions": [ 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-5" }, { "model_record_id": "AF-Q9ULU4-6-F1:v6", "model_accession": "Q9ULU4-6", "protein_id": "UP:Q9ULU4", "sequence_length": 1023, "sequence_sha256": "37e4795dd09da1182f27d0b0386bf8ecde18abaae98684026082159e9e8e17ad", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 132, "isoform_end": 182, "isoform_positions": [ 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-6" }, { "model_record_id": "AF-Q9ULU4-7-F1:v6", "model_accession": "Q9ULU4-7", "protein_id": "UP:Q9ULU4", "sequence_length": 1234, "sequence_sha256": "5678e75314860b7ca764cb2d5ff7d95395cadf7e779dae96758b03065e84b41b", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 297, "isoform_end": 347, "isoform_positions": [ 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-7" }, { "model_record_id": "AF-Q9ULU4-8-F1:v6", "model_accession": "Q9ULU4-8", "protein_id": "UP:Q9ULU4", "sequence_length": 1107, "sequence_sha256": "d587595dbe467f2d2205f4e15c7274c7ea08092e6390a185ed511ea8a0bf6204", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 297, "isoform_end": 347, "isoform_positions": [ 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-8" }, { "model_record_id": "AF-Q9ULU4-9-F1:v6", "model_accession": "Q9ULU4-9", "protein_id": "UP:Q9ULU4", "sequence_length": 1168, "sequence_sha256": "9a56fd09fe1544fb511deb35cefdf3d891d63defa91c86c724856a443afb1441", "isoform_mapping_method": "official_UniProt_VSP_edits", "source_api_url": "https://alphafold.ebi.ac.uk/api/prediction/Q9ULU4", "domain_id": "UP:Q9ULU4:PWWP1", "core_retention": "complete", "mapped_observed_core_residues": 51, "domain_length": 51, "isoform_start": 277, "isoform_end": 327, "isoform_positions": [ 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327 ], "domain_name": "PWWP1", "validated_edits": [], "correction_note": null, "source_url": "https://www.uniprot.org/uniprotkb/Q9ULU4-9" } ], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "Q8R5C8": { "uniprot": "Q8R5C8", "gene": "Zmynd11", "protein_id": "UP:Q8R5C8", "length": 602, "sequence_sha256": "202a800822e81e5edf447811fa4af21974799de8f257f2c6e065413b7ea5dfcb", "domains": [ { "domain_id": "UP:Q8R5C8:PWWP1", "domain_name": "PWWP1", "start": 280, "end": 331, "source": "UniProtKB DOMAIN", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [ { "feature_id": "Q8R5C8:UPFEATURE:1", "type": "Domain", "name": "SAMD1-like winged helix (WH)", "start": 6, "end": 82, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q8R5C8.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU01358" } ], "source_index": 1 }, { "feature_id": "Q8R5C8:UPFEATURE:4", "type": "Zinc finger", "name": "PHD-type", "start": 100, "end": 148, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q8R5C8.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00146" } ], "source_index": 4 }, { "feature_id": "Q8R5C8:UPFEATURE:2", "type": "Domain", "name": "Bromo", "start": 149, "end": 255, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q8R5C8.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00035" } ], "source_index": 2 }, { "feature_id": "Q8R5C8:UPFEATURE:5", "type": "Zinc finger", "name": "MYND-type", "start": 563, "end": 598, "source": "UniProtKB canonical feature", "source_url": "https://rest.uniprot.org/uniprotkb/Q8R5C8.json", "evidence": [ { "evidenceCode": "ECO:0000255", "source": "PROSITE-ProRule", "id": "PRU00134" } ], "source_index": 5 } ], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "Q8R5C8", "source_url": "https://rest.uniprot.org/uniprotkb/Q8R5C8.json", "final_url": "https://rest.uniprot.org/uniprotkb/Q8R5C8.json", "retrieved_utc": "2026-10-26T17:49:29.859041+00:00", "source_last_modified": null, "sha256": "a6daa1982e7627e3855397c949ef45e0208ff5e5e9bd77aaff28a8566d06738a", "bytes": 41854, "entry_audit": { "firstPublicDate": "2004-05-10", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2012-11-28", "entryVersion": 167, "sequenceVersion": 2 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "202a800822e81e5edf447811fa4af21974799de8f257f2c6e065413b7ea5dfcb", "source_sequence_sha256": "202a800822e81e5edf447811fa4af21974799de8f257f2c6e065413b7ea5dfcb", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "4N4G", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 154, 371 ] ], "observed_ranges": [ [ 154, 175 ], [ 180, 366 ] ], "construct_length": 252, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 34 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:Q8R5C8:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 52, "annotation_core_length": 52 } ], "source_url": "https://www.rcsb.org/structure/4N4G", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "O59676": { "uniprot": "O59676", "gene": "pdp1", "protein_id": "UP:O59676", "length": 359, "sequence_sha256": "f8a25860017774a66ff8a5238aea4c29c4ceb7b506c969b7e717f691ff9e282f", "domains": [ { "domain_id": "UP:O59676:PWWP1", "domain_name": "PWWP1", "start": 52, "end": 114, "source": "UniProtKB DOMAIN", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "O59676", "source_url": "https://rest.uniprot.org/uniprotkb/O59676.json", "final_url": "https://rest.uniprot.org/uniprotkb/O59676.json", "retrieved_utc": "2026-10-26T17:49:25.002330+00:00", "source_last_modified": null, "sha256": "105b1fb58743a1223abd23bb303cbd04cdb0f4b649911e328dcbdbfef3b1ace3", "bytes": 17988, "entry_audit": { "firstPublicDate": "2007-09-11", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "1998-08-01", "entryVersion": 137, "sequenceVersion": 1 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "f8a25860017774a66ff8a5238aea4c29c4ceb7b506c969b7e717f691ff9e282f", "source_sequence_sha256": "f8a25860017774a66ff8a5238aea4c29c4ceb7b506c969b7e717f691ff9e282f", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "2L89", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 45, 152 ] ], "observed_ranges": [ [ 45, 152 ] ], "construct_length": 108, "mapped_sequence_identity": 0.990741, "unmapped_construct_ranges": [], "sequence_mismatches": [ { "construct": "L", "entity_position": 107, "reference": "E", "uniprot_position": 151 } ], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:O59676:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 63, "annotation_core_length": 63 } ], "source_url": "https://www.rcsb.org/structure/2L89", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." }, "O94312": { "uniprot": "O94312", "gene": "pdp2", "protein_id": "UP:O94312", "length": 568, "sequence_sha256": "0426b8d1f26420a736c07405702852e2e600149152a2a7516a558cf9c60ebcfd", "domains": [ { "domain_id": "UP:O94312:PWWP1", "domain_name": "PWWP1", "start": 125, "end": 189, "source": "UniProtKB DOMAIN", "membership_tier": "annotation_supported", "boundary_scope": "annotation core; not a certified complete folded domain or pocket" } ], "other_features": [], "source_status": "UniProt feature coordinates accepted after exact canonical sequence identity check against the frozen Atlas.", "uniprot_source": { "accession": "O94312", "source_url": "https://rest.uniprot.org/uniprotkb/O94312.json", "final_url": "https://rest.uniprot.org/uniprotkb/O94312.json", "retrieved_utc": "2026-10-26T17:49:25.049857+00:00", "source_last_modified": null, "sha256": "5bd23e13e7dfc7bfb3d2950e1be1c42809f278ca0124cb43ebe12a768e5997ae", "bytes": 14997, "entry_audit": { "firstPublicDate": "2004-08-31", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "1999-05-01", "entryVersion": 139, "sequenceVersion": 1 }, "sequence_matches_frozen_atlas": true, "frozen_sequence_sha256": "0426b8d1f26420a736c07405702852e2e600149152a2a7516a558cf9c60ebcfd", "source_sequence_sha256": "0426b8d1f26420a736c07405702852e2e600149152a2a7516a558cf9c60ebcfd", "annotation_usage": "eligible: exact canonical sequence match" }, "constructs": [ { "pdb_id": "1H3Z", "chain": "A", "auth_chains": [ "A" ], "mapped_ranges": [ [ 118, 225 ] ], "observed_ranges": [ [ 118, 225 ] ], "construct_length": 109, "mapped_sequence_identity": 1.0, "unmapped_construct_ranges": [ [ 1, 1 ] ], "sequence_mismatches": [], "engineering_status": "sequence differences or tags detected; biological versus engineered origin requires review", "coverage": [ { "domain_id": "UP:O94312:PWWP1", "domain_name": "PWWP1", "observed_core_residues": 65, "annotation_core_length": 65 } ], "source_url": "https://www.rcsb.org/structure/1H3Z", "mapping_source": "Frozen SIFTS aligned regions with construct-to-UniProt sequence comparison", "mapping_note": "Bars are mapped canonical segments; tags, insertions, and unmapped termini are not assigned canonical positions." } ], "construct_selection": "One mapped example per native domain, preferring frozen experimental representatives; up to four distinct mapped intervals.", "isoforms": [], "isoform_scope": "Only source-validated PWWP core correspondences from the frozen v1.2 isoform audit; other-domain architectures are not projected onto isoforms." } }, "literature": [ { "id": "DOI:10.1021/acs.jmedchem.6c00983", "reference_id": "PMID:42503659", "reference_ids": [ "PMID:42503659" ], "title": "AI-Driven Discovery of a Hydrophobic-Tag Degrader Targeting NSD3 for Lung Squamous Carcinoma Therapy.", "authors": [ "Xiu SY", "Jia ZY", "Li Q", "Zhu WY", "Wang H", "Shi C", "Zhou JX", "Sun XJ", "Zhang XY", "Wang YY", "Chi XW", "Zhang LR", "Liu ZM" ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Journal of medicinal chemistry", "doi": "10.1021/acs.jmedchem.6c00983", "pmid": 42503659, "url": "https://doi.org/10.1021/acs.jmedchem.6c00983", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Published AI-driven NSD3 degrader discovery", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:42503659", "year": 2026, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1021/acs.jmedchem.6c00983" } ], "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1080/07391102.2026.2698738", "reference_id": "PMID:42444282", "reference_ids": [ "PMID:42444282" ], "title": "Computational analysis of non-synonymous SNPs-induced structural perturbations and histone binding alterations in the PWWP domain of PWWP2A and PWWP2B proteins.", "authors": [ "M S", "N S", "Oviya IR", "R J", "Ganesh I", "Chinnadurai RK", "Ponne S" ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Journal of biomolecular structure & dynamics", "doi": "10.1080/07391102.2026.2698738", "pmid": 42444282, "url": "https://doi.org/10.1080/07391102.2026.2698738", "source_type": "primary_computational_study", "citation_role": "pwwp_research_context", "citation_role_label": "Computational study", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Published computational variant study; computational rather than experimental evidence", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:42444282", "year": 2026, "source_type": "primary_computational_study", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1080/07391102.2026.2698738" } ], "proteins": [ { "protein_id": "UP:Q6NUJ5", "uniprot": "Q6NUJ5", "gene": "PWWP2B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q96N64", "uniprot": "Q96N64", "gene": "PWWP2A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/s41467-026-76698-8", "reference_id": "REF:PDB:9S28:primary", "reference_ids": [ "REF:PDB:9S28:primary" ], "title": "Core nucleosomes are refractory to lentiviral DNA integration.", "authors": [ "Hope, J.", "Punch, E.", "Cook, N.J.", "Singer, M.R.", "Joshi, D.", "Singh, P.K.", "Nans, A.", "Sweeney, N.P.", "Vanderlinden, W.", "Engelman, A.N.", "Cherepanov, P." ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Nat Commun", "doi": "10.1038/s41467-026-76698-8", "pmid": 42749731, "url": "https://doi.org/10.1038/s41467-026-76698-8", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:9S28:primary", "year": 2026, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1038/s41467-026-76698-8" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9S28", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "9S29", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1002/pro.70726", "reference_id": "PMID:42489162", "reference_ids": [ "PMID:42489162" ], "title": "De novo design of proteinaceous binders targeting the LEDGF PWWP domain.", "authors": [ "Vantieghem T", "Delepine J", "Noppen S", "Beelen S", "Drexler M", "Holková J", "Houser J", "Veverka V", "Schols D", "Strelkov SV" ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Protein science : a publication of the Protein Society", "doi": "10.1002/pro.70726", "pmid": 42489162, "url": "https://doi.org/10.1002/pro.70726", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Designed JUBO protein binders and LEDGF PWWP complex", "verification_level": "primary_abstract_and_data_availability_verified", "source_records": [ { "reference_id": "PMID:42489162", "year": 2026, "source_type": "primary_experimental_research", "verification_level": "primary_abstract_and_data_availability_verified", "url": "https://doi.org/10.1002/pro.70726" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9S81", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9S83", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.bmc.2026.118751", "reference_id": "PMID:42442058", "reference_ids": [ "PMID:42442058" ], "title": "Discovery and biological evaluation of HS13 as a novel covalent ligand targeting the NSD2-PWWP1 domain.", "authors": [ "Liu C", "Wang Q", "Xie X", "Wang H", "Liu S", "Li B", "Min J", "Chen X", "Huang Y" ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Bioorganic & medicinal chemistry", "doi": "10.1016/j.bmc.2026.118751", "pmid": 42442058, "url": "https://doi.org/10.1016/j.bmc.2026.118751", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "HS13 covalent NSD2 PWWP1 ligand", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:42442058", "year": 2026, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.bmc.2026.118751" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [ { "name": "HS13", "preparation_id": "PREP:HS13", "chemical_identity_status": "paper_label_exact_identity_unresolved", "assay_ids": [ "PWWP:ASSAY:0035" ], "evidence_classes": [ "abstract_reported_covalent_association" ], "domain_ids": [ "UP:O96028:PWWP1" ] } ], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1021/acs.analchem.5c07785", "reference_id": "PMID:41820229", "reference_ids": [ "PMID:41820229" ], "title": "Fluorogenic Ligand Enables Identification of NSD3-Overexpressed Tumors by Targeting the PWWP1 Domain of NSD3.", "authors": [ "Li Y", "Shao S", "Lei Q", "Song C", "Wang S", "Deng H" ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Analytical chemistry", "doi": "10.1021/acs.analchem.5c07785", "pmid": 41820229, "url": "https://doi.org/10.1021/acs.analchem.5c07785", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "NSD3 PWWP1-targeting fluorogenic ligand", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:41820229", "year": 2026, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1021/acs.analchem.5c07785" } ], "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.3390/biom16050716", "reference_id": "PMID:42194065", "reference_ids": [ "PMID:42194065" ], "title": "High-Affinity Nanobody Against the LEDGF PWWP Domain Inhibits Chromatin Binding In Vitro.", "authors": [ "Vantieghem T", "Jansen S", "Akele TZ", "Van Maele P", "Noppen S", "Schols D", "Dewilde M", "Debyser Z", "Strelkov SV" ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Biomolecules", "doi": "10.3390/biom16050716", "pmid": 42194065, "url": "https://doi.org/10.3390/biom16050716", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP nanobody binding; binder-alone crystal structures are not PWWP structures", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:42194065", "year": 2026, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.3390/biom16050716" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" }, { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" }, { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [ { "name": "NbH10", "preparation_id": "PREP:NbH10", "chemical_identity_status": "named_macromolecule_no_full_sequence_identity", "assay_ids": [ "PWWP11:ASSAY:0008", "PWWP11:ASSAY:0009", "PWWP:ASSAY:0032" ], "evidence_classes": [ "biochemical_interaction_inhibition", "direct_binding_affinity" ], "domain_ids": [ "UP:O75475:PWWP1", "UP:Q7Z4V5:PWWP1" ] } ], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/s41594-025-01704-4", "reference_id": "REF:PDB:9MP0:primary", "reference_ids": [ "REF:PDB:9MP0:primary" ], "title": "Mechanisms of DNMT3A-3L-mediated de novo DNA methylation on chromatin.", "authors": [ "Yan, Y.", "Zhou, X.E.", "Thomas, S.L.", "Liu, M.", "Lai, G.Q.", "Worden, E.J.", "Jones, P.A.", "Xu, T.H." ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Nat.Struct.Mol.Biol.", "doi": "10.1038/s41594-025-01704-4", "pmid": 41174279, "url": "https://doi.org/10.1038/s41594-025-01704-4", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:9MP0:primary", "year": 2026, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1038/s41594-025-01704-4" } ], "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9MP0", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "9MPO", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "9MPP", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/s41467-025-67710-8", "reference_id": "REF:PDB:9LQ1:primary", "reference_ids": [ "REF:PDB:9LQ1:primary" ], "title": "Molecular basis for the inhibition of de novo DNA methylation by TCL1A.", "authors": [ "Liu, Q.", "Li, J.", "Wang, X.", "Li, Y.", "Wu, Y.", "Han, Z.", "Guo, Z.", "Guo, L.", "Wang, X.", "Yuan, G.", "Gao, Z.", "Li, L.", "Deng, D." ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Nat Commun", "doi": "10.1038/s41467-025-67710-8", "pmid": 41786706, "url": "https://doi.org/10.1038/s41467-025-67710-8", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:9LQ1:primary", "year": 2026, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1038/s41467-025-67710-8" } ], "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9LQ1", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1073/pnas.2609226123", "reference_id": "REF:PDB:11NZ:primary", "reference_ids": [ "REF:PDB:11NZ:primary" ], "title": "Multidomain interaction governs the filamentous assembly of the dominant-negative DNMT3A R882H mutant.", "authors": [ "Chen, J.", "Lu, J.", "Long, Z.", "Yoon, S.", "Fukunaga, M.", "Song, J." ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Proc.Natl.Acad.Sci.USA", "doi": "10.1073/pnas.2609226123", "pmid": 42640801, "url": "https://doi.org/10.1073/pnas.2609226123", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:11NZ:primary", "year": 2026, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1073/pnas.2609226123" } ], "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "11NZ", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "11OA", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "11OH", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "11OI", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1182/blood.2025031998", "reference_id": "REF:PDB:9Y60:primary", "reference_ids": [ "REF:PDB:9Y60:primary" ], "title": "NSD2 degradation remediates the oncogenic cistrome in t(4;14) multiple myeloma.", "authors": [ "Hu, B.", "Edwards, J.T.", "Modi, H.", "Gamez, J.", "Echeagaray, O.", "Hess, K.", "Ren, Y.", "Anderson, D.", "Larrayoz, M.", "Zhu, J.", "Johnson, S.", "Deb, G.", "Jankeel, D.", "Janardhanan, P.", "Leisten, J.", "Peng, S.", "Christoforou, A.", "Stong, N.", "Fontanillo, C.", "Bjorklund, C.C.", "Hagner, P.R.", "Gandhi, A.K.", "Martinez-Climent, J.A.", "Narla, R.K.", "Lopez-Girona, A.", "Rolfe, M.", "Bence, N.", "Mortensen, D.S.", "Groocock, L." ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Blood", "doi": "10.1182/blood.2025031998", "pmid": 42371798, "url": "https://doi.org/10.1182/blood.2025031998", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:9Y60:primary", "year": 2026, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1182/blood.2025031998" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9Y60", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9Y61", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.molcel.2026.01.030", "reference_id": "PMID:41742418", "reference_ids": [ "PMID:41742418" ], "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "authors": [ "Xie X", "Liu M", "Chua GNL", "Zhou XE", "Dykstra ML", "Liu S", "Jones PA", "Worden EJ" ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Molecular cell", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Nucleosome spacing and linker methylation structural context", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:41742418", "year": 2026, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.molcel.2026.01.030" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E00", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "9E05", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9E0F", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9E0G", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9E2D", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9E2Q", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "9E2R", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9E3D", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9E3R", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "9Q7U", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9Y4P", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/s41467-026-72235-9", "reference_id": "REF:PDB:29HG:primary", "reference_ids": [ "REF:PDB:29HG:primary" ], "title": "Structural basis of NSD2 degradation via targeted recruitment of SCF-FBXO22.", "authors": [ "Robertson, K.C.", "Amann, S.J.", "Liu, T.", "Funk, A.V.", "Wang, X.", "Grishkovskaya, I.", "Mehmood, A.", "Tabor, J.R.", "Norris-Drouin, J.L.", "Arrowsmith, C.H.", "Collins, J.L.", "Miao, Y.", "Emanuele, M.J.", "Haselbach, D.", "James, L.I.", "Brown, N.G." ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Nat Commun", "doi": "10.1038/s41467-026-72235-9", "pmid": 42026065, "url": "https://doi.org/10.1038/s41467-026-72235-9", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:29HG:primary", "year": 2026, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1038/s41467-026-72235-9" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "29HG", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "29HH", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "29HI", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/s41467-026-69563-1", "reference_id": "PMID:41708613", "reference_ids": [ "PMID:41708613" ], "title": "Structural insight into hierarchical DNMT3A autoinhibition and its dysregulation in disease.", "authors": [ "Lu J", "Vig E", "Chen J", "Gretarsson KH", "Khudaverdyan N", "Shao Z", "Lu C", "Chang CA", "Song J" ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Nature communications", "doi": "10.1038/s41467-026-69563-1", "pmid": 41708613, "url": "https://doi.org/10.1038/s41467-026-69563-1", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Hierarchical DNMT3A autoinhibition; review coordinate-level PWWP coverage", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:41708613", "year": 2026, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1038/s41467-026-69563-1" } ], "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9PRW", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1093/nar/gkag357", "reference_id": "REF:PDB:9XYC:primary", "reference_ids": [ "REF:PDB:9XYC:primary" ], "title": "Structure and function of IWS1 in transcription elongation.", "authors": [ "Syau, D.", "Steinruecke, F.", "Roth, S.", "Schmid, E.", "Adelman, K.", "Walter, J.C.", "Farnung, L." ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Nucleic Acids Res.", "doi": "10.1093/nar/gkag357", "pmid": 42134803, "url": "https://doi.org/10.1093/nar/gkag357", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:9XYC:primary", "year": 2026, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1093/nar/gkag357" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9XYC", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1107/s2053230x25006302", "reference_id": "PMID:40709919", "reference_ids": [ "PMID:40709919" ], "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "authors": [ "Vantieghem T", "Osipov EM", "Beelen S", "Strelkov SV" ], "year": 2025, "year_values": [ 2025 ], "year_conflict": false, "journal": "Acta crystallographica. Section F, Structural biology communications", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "url": "https://doi.org/10.1107/s2053230x25006302", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "HRP2 PWWP C64S crystallization engineering and lattice comparison", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:40709919", "year": 2025, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1107/s2053230x25006302" } ], "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7A", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9I7B", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9I7C", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9I7D", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9I7E", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9I7F", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9I7G", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9I7H", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9I7I", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9I7J", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1021/acs.jmedchem.5c01902", "reference_id": "REF:PDB:9KN9:primary", "reference_ids": [ "REF:PDB:9KN9:primary" ], "title": "Fragment-Based Screening of NSD2-PWWP1 Identifies Novel Covalent Allosteric Ligands That Diminish Methyllysine and DNA Binding Abilities of NSD2.", "authors": [ "Huang, Y.", "Li, Y.", "Chen, X.", "Wang, H.", "Wang, Q.", "Liu, S.", "Li, Y.", "Chen, Z.", "Ma, J.", "Huang, Z.", "Wan, J.", "Ren, Y.", "Min, J." ], "year": 2025, "year_values": [ 2025 ], "year_conflict": false, "journal": "J.Med.Chem.", "doi": "10.1021/acs.jmedchem.5c01902", "pmid": 41264880, "url": "https://doi.org/10.1021/acs.jmedchem.5c01902", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:9KN9:primary", "year": 2025, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1021/acs.jmedchem.5c01902" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9KN9", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9KNA", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9KNB", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1126/sciadv.adu8116", "reference_id": "PMID:40138405", "reference_ids": [ "PMID:40138405" ], "title": "Histone modification-driven structural remodeling unleashes DNMT3B in DNA methylation.", "authors": [ "Cho CC", "Huang HH", "Jiang BC", "Yang WZ", "Chen YN", "Yuan HS" ], "year": 2025, "year_values": [ 2025 ], "year_conflict": false, "journal": "Science advances", "doi": "10.1126/sciadv.adu8116", "pmid": 40138405, "url": "https://doi.org/10.1126/sciadv.adu8116", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Histone-driven DNMT3B structural remodeling and DNA methylation", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:40138405", "year": 2025, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1126/sciadv.adu8116" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8ZLK", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1021/acsmedchemlett.5c00396", "reference_id": "PMID:40959233", "reference_ids": [ "PMID:40959233" ], "title": "Structural and Molecular Insight into the PWWP1 Domain of NSD2 from the Discovery of Novel Binders Via DNA-Encoded Library Screening.", "authors": [ "Collie GW", "Ackroyd B", "Corbishley C", "O'Donovan DH", "Edwards A", "Gohlke A", "Guo X", "Howells B", "Li Y", "Madin A", "Milbradt AG", "Rivers EL", "Talapatra SK", "Underwood E", "Webb A" ], "year": 2025, "year_values": [ 2025 ], "year_conflict": false, "journal": "ACS medicinal chemistry letters", "doi": "10.1021/acsmedchemlett.5c00396", "pmid": 40959233, "url": "https://doi.org/10.1021/acsmedchemlett.5c00396", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "NSD2 PWWP1 DEL binders, extended construct, and engineered crystal systems", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:40959233", "year": 2025, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1021/acsmedchemlett.5c00396" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9FOC", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9FOE", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" }, { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [ { "name": "UNC6934", "preparation_id": "PREP:UNC6934", "chemical_identity_status": "exact_single_CCD_identity", "assay_ids": [ "PWWP11:ASSAY:0001", "PWWP:ASSAY:0014", "PWWP:ASSAY:0021" ], "evidence_classes": [ "censored_binding_limit", "direct_binding_affinity" ], "domain_ids": [ "UP:O96028:PWWP1", "UP:Q9BZ95:PWWP1" ] }, { "name": "compound 11 (Collie 2025)", "preparation_id": "PREP:COLLIE2025_11", "chemical_identity_status": "assayed_stereoisomeric_mixture_not_single_chemical_identity", "assay_ids": [ "PWWP11:ASSAY:0005", "PWWP:ASSAY:0018", "PWWP:ASSAY:0025" ], "evidence_classes": [ "direct_binding_affinity", "negative_binding_test" ], "domain_ids": [ "UP:O96028:PWWP1", "UP:Q9BZ95:PWWP1" ] }, { "name": "compound 12 (Collie 2025)", "preparation_id": "PREP:COLLIE2025_12", "chemical_identity_status": "paper_label_exact_identity_unresolved", "assay_ids": [ "PWWP11:ASSAY:0006", "PWWP:ASSAY:0019", "PWWP:ASSAY:0026", "PWWP:ASSAY:0030" ], "evidence_classes": [ "biochemical_interaction_inhibition", "direct_binding_affinity", "negative_binding_test" ], "domain_ids": [ "UP:O96028:PWWP1", "UP:Q9BZ95:PWWP1" ] }, { "name": "compound 13 (Collie 2025)", "preparation_id": "PREP:COLLIE2025_13", "chemical_identity_status": "paper_label_exact_identity_unresolved", "assay_ids": [ "PWWP11:ASSAY:0007", "PWWP:ASSAY:0020", "PWWP:ASSAY:0027", "PWWP:ASSAY:0031" ], "evidence_classes": [ "biochemical_interaction_inhibition", "direct_binding_affinity", "negative_binding_test" ], "domain_ids": [ "UP:O96028:PWWP1", "UP:Q9BZ95:PWWP1" ] }, { "name": "compound 5 (Collie 2025)", "preparation_id": "PREP:COLLIE2025_5", "chemical_identity_status": "assayed_stereoisomeric_mixture_not_single_chemical_identity", "assay_ids": [ "PWWP11:ASSAY:0002", "PWWP:ASSAY:0015", "PWWP:ASSAY:0022" ], "evidence_classes": [ "censored_binding_limit", "direct_binding_affinity" ], "domain_ids": [ "UP:O96028:PWWP1", "UP:Q9BZ95:PWWP1" ] }, { "name": "compound 6 (Collie 2025)", "preparation_id": "PREP:COLLIE2025_6", "chemical_identity_status": "paper_label_exact_identity_unresolved", "assay_ids": [ "PWWP11:ASSAY:0003", "PWWP:ASSAY:0016", "PWWP:ASSAY:0023", "PWWP:ASSAY:0028" ], "evidence_classes": [ "biochemical_interaction_inhibition", "censored_binding_limit", "direct_binding_affinity" ], "domain_ids": [ "UP:O96028:PWWP1", "UP:Q9BZ95:PWWP1" ] }, { "name": "compound 7 (Collie 2025)", "preparation_id": "PREP:COLLIE2025_7", "chemical_identity_status": "exact_single_CCD_identity", "assay_ids": [ "PWWP11:ASSAY:0004", "PWWP:ASSAY:0017", "PWWP:ASSAY:0024", "PWWP:ASSAY:0029" ], "evidence_classes": [ "biochemical_interaction_inhibition", "censored_binding_limit", "direct_binding_affinity" ], "domain_ids": [ "UP:O96028:PWWP1", "UP:Q9BZ95:PWWP1" ] } ], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/s42003-025-07895-2", "reference_id": "PMID:40089621", "reference_ids": [ "PMID:40089621" ], "title": "Structural basis of thymidine-rich DNA recognition by Drosophila P75 PWWP domain.", "authors": [ "Jin Z", "Meng Z", "Liu Y", "Li C", "Zhang X", "Yin Y", "Gao G", "Dou K", "Huang Y" ], "year": 2025, "year_values": [ 2025 ], "year_conflict": false, "journal": "Communications biology", "doi": "10.1038/s42003-025-07895-2", "pmid": 40089621, "url": "https://doi.org/10.1038/s42003-025-07895-2", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Drosophila P75 PWWP thymidine-rich DNA recognition", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:40089621", "year": 2025, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1038/s42003-025-07895-2" } ], "proteins": [], "structures": [ { "pdb_id": "6KCO", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6KD6", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1021/acs.jmedchem.3c01765", "reference_id": "PMID:38687638", "reference_ids": [ "PMID:38687638" ], "title": "Discovery of LLC0424 as a Potent and Selective in Vivo NSD2 PROTAC Degrader.", "authors": [ "Liu L", "Parolia A", "Liu Y", "Hou C", "He T", "Qiao Y", "Eyunni S", "Luo J", "Li C", "Wang Y", "Zhou F", "Huang W", "Ren X", "Wang Z", "Chinnaiyan AM", "Ding K" ], "year": 2024, "year_values": [ 2024 ], "year_conflict": false, "journal": "Journal of medicinal chemistry", "doi": "10.1021/acs.jmedchem.3c01765", "pmid": 38687638, "url": "https://doi.org/10.1021/acs.jmedchem.3c01765", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "LLC0424 NSD2 PROTAC", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "source_records": [ { "reference_id": "PMID:38687638", "year": 2024, "source_type": "primary_experimental_research", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "url": "https://doi.org/10.1021/acs.jmedchem.3c01765" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1002/1873-3468.14981", "reference_id": "PMID:39031937", "reference_ids": [ "PMID:39031937" ], "title": "Fragment-based discovery of small molecule inhibitors of the HDGFRP2 PWWP domain.", "authors": [ "Wei X", "Li S", "Li Z", "Wang L", "Fan W", "Ruan K", "Gao J" ], "year": 2024, "year_values": [ 2024 ], "year_conflict": false, "journal": "FEBS letters", "doi": "10.1002/1873-3468.14981", "pmid": 39031937, "url": "https://doi.org/10.1002/1873-3468.14981", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Varenicline and BPP fragment ligands of HDGFL2 PWWP", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:39031937", "year": 2024, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1002/1873-3468.14981" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" }, { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8Z6C", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "8Z6O", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" }, { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" }, { "domain_id": "UP:Q9Y3E1:PWWP1", "gene": "HDGFL3", "domain_name": "PWWP1" } ], "ligands": [ { "name": "BPP", "preparation_id": "PREP:BPP", "chemical_identity_status": "exact_single_CCD_identity", "assay_ids": [ "PWWP:ASSAY:0011", "PWWP:ASSAY:0012", "PWWP:ASSAY:0013" ], "evidence_classes": [ "direct_binding_affinity" ], "domain_ids": [ "UP:O75475:PWWP1", "UP:Q7Z4V5:PWWP1", "UP:Q9Y3E1:PWWP1" ] }, { "name": "varenicline", "preparation_id": "PREP:VARENICLINE", "chemical_identity_status": "exact_single_CCD_identity", "assay_ids": [ "PWWP:ASSAY:0010" ], "evidence_classes": [ "direct_binding_affinity" ], "domain_ids": [ "UP:Q7Z4V5:PWWP1" ] } ], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1021/acs.jmedchem.4c00215", "reference_id": "REF:PDB:9EXW:primary", "reference_ids": [ "REF:PDB:9EXW:primary" ], "title": "Identification of Novel Potent NSD2-PWWP1 Ligands Using Structure-Based Design and Computational Approaches.", "authors": [ "Carlino, L.", "Astles, P.C.", "Ackroyd, B.", "Ahmed, A.", "Chan, C.", "Collie, G.W.", "Dale, I.L.", "O'Donovan, D.H.", "Fawcett, C.", "di Fruscia, P.", "Gohlke, A.", "Guo, X.", "Hao-Ru Hsu, J.", "Kaplan, B.", "Milbradt, A.G.", "Northall, S.", "Petrovic, D.", "Rivers, E.L.", "Underwood, E.", "Webb, A." ], "year": 2024, "year_values": [ 2024 ], "year_conflict": false, "journal": "J.Med.Chem.", "doi": "10.1021/acs.jmedchem.4c00215", "pmid": 38748070, "url": "https://doi.org/10.1021/acs.jmedchem.4c00215", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:9EXW:primary", "year": 2024, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1021/acs.jmedchem.4c00215" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9EXW", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9EXX", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9EXY", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.ejmech.2024.116965", "reference_id": "PMID:39413441", "reference_ids": [ "PMID:39413441" ], "title": "Inhibitors targeting the PWWP domain-containing proteins.", "authors": [ "Huang Y", "Li B", "Wu Z", "Liu K", "Min J" ], "year": 2024, "year_values": [ 2024 ], "year_conflict": false, "journal": "European journal of medicinal chemistry", "doi": "10.1016/j.ejmech.2024.116965", "pmid": 39413441, "url": "https://doi.org/10.1016/j.ejmech.2024.116965", "source_type": "review", "citation_role": "pwwp_research_context", "citation_role_label": "Review / synthesis", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP inhibitor discovery review for citation chaining only", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:39413441", "year": 2024, "source_type": "review", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.ejmech.2024.116965" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" }, { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" }, { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.ejmech.2024.116960", "reference_id": "PMID:39461037", "reference_ids": [ "PMID:39461037" ], "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "authors": [ "Vantieghem T", "Aslam NA", "Osipov EM", "Akele M", "Van Belle S", "Beelen S", "Drexler M", "Paulovcakova T", "Lux V", "Fearon D", "Douangamath A", "von Delft F", "Christ F", "Veverka V", "Verwilst P", "Van Aerschot A", "Debyser Z", "Strelkov SV" ], "year": 2024, "year_values": [ 2024 ], "year_conflict": false, "journal": "European journal of medicinal chemistry", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "68-fragment HRP-family crystallographic screen and rational fragment expansion", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:39461037", "year": 2024, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.ejmech.2024.116960" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" }, { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG0", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HG1", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HG2", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HG3", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HG4", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HG5", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HG6", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HG7", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HG8", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HG9", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGA", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGB", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGC", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGD", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGE", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGF", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGG", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGH", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGI", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGJ", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGK", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGL", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGM", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGN", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGO", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGP", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGQ", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGR", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGS", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGT", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGU", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGV", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGW", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGX", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGY", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGZ", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH0", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH1", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH2", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH3", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH4", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH5", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH6", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH7", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH8", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH9", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHA", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHB", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHC", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHD", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHE", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHF", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHG", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHH", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHI", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHJ", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHK", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHL", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHM", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHN", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHO", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHP", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHQ", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHR", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9G91", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9G94", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9G96", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9GRS", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9GRT", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9GRU", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9GRV", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/s44319-024-00306-3", "reference_id": "REF:PDB:8QZM:primary", "reference_ids": [ "REF:PDB:8QZM:primary" ], "title": "The N-terminal region of DNMT3A engages the nucleosome surface to aid chromatin recruitment.", "authors": [ "Wapenaar, H.", "Clifford, G.", "Rolls, W.", "Pasquier, M.", "Burdett, H.", "Zhang, Y.", "Deak, G.", "Zou, J.", "Spanos, C.", "Taylor, M.R.D.", "Mills, J.", "Watson, J.A.", "Kumar, D.", "Clark, R.", "Das, A.", "Valsakumar, D.", "Bramham, J.", "Voigt, P.", "Sproul, D.", "Wilson, M.D." ], "year": 2024, "year_values": [ 2024 ], "year_conflict": false, "journal": "Embo Rep.", "doi": "10.1038/s44319-024-00306-3", "pmid": 39528729, "url": "https://doi.org/10.1038/s44319-024-00306-3", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:8QZM:primary", "year": 2024, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1038/s44319-024-00306-3" } ], "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8QZM", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1021/jacs.3c01421", "reference_id": "PMID:36976643", "reference_ids": [ "PMID:36976643" ], "title": "Discovery of a Potent and Selective Targeted NSD2 Degrader for the Reduction of H3K36me2.", "authors": [ "Hanley RP", "Nie DY", "Tabor JR", "Li F", "Sobh A", "Xu C", "Barker NK", "Dilworth D", "Hajian T", "Gibson E", "Szewczyk MM", "Brown PJ", "Barsyte-Lovejoy D", "Herring LE", "Wang GG", "Licht JD", "Vedadi M", "Arrowsmith CH", "James LI" ], "year": 2023, "year_values": [ 2023 ], "year_conflict": false, "journal": "Journal of the American Chemical Society", "doi": "10.1021/jacs.3c01421", "pmid": 36976643, "url": "https://doi.org/10.1021/jacs.3c01421", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "NSD2 degrader targeting H3K36me2 reduction", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:36976643", "year": 2023, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1021/jacs.3c01421" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1093/nar/gkad674", "reference_id": "PMID:37615563", "reference_ids": [ "PMID:37615563" ], "title": "Multivalency of nucleosome recognition by LEDGF.", "authors": [ "Koutná E", "Lux V", "Kouba T", "Škerlová J", "Nováček J", "Srb P", "Hexnerová R", "Šváchová H", "Kukačka Z", "Novák P", "Fábry M", "Poepsel S", "Veverka V" ], "year": 2023, "year_values": [ 2023 ], "year_conflict": false, "journal": "Nucleic acids research", "doi": "10.1093/nar/gkad674", "pmid": 37615563, "url": "https://doi.org/10.1093/nar/gkad674", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Multivalent LEDGF nucleosome recognition", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:37615563", "year": 2023, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1093/nar/gkad674" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8CBN", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "8CBQ", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "8PC5", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "8PC6", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "8PEO", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "8PEP", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1093/nar/gkad972", "reference_id": "REF:PDB:8EIH:primary", "reference_ids": [ "REF:PDB:8EIH:primary" ], "title": "Structural basis for the allosteric regulation and dynamic assembly of DNMT3B.", "authors": [ "Lu, J.", "Fang, J.", "Zhu, H.", "Liang, K.L.", "Khudaverdyan, N.", "Song, J." ], "year": 2023, "year_values": [ 2023 ], "year_conflict": false, "journal": "Nucleic Acids Res.", "doi": "10.1093/nar/gkad972", "pmid": 37941146, "url": "https://doi.org/10.1093/nar/gkad972", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:8EIH:primary", "year": 2023, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1093/nar/gkad972" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8EIH", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "8EII", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "8EIJ", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "8EIK", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1093/nar/gkad015", "reference_id": "REF:PDB:8AG6:primary", "reference_ids": [ "REF:PDB:8AG6:primary" ], "title": "Unexpected moves: a conformational change in MutS alpha enables high-affinity DNA mismatch binding.", "authors": [ "Bruekner, S.R.", "Pieters, W.", "Fish, A.", "Liaci, A.M.", "Scheffers, S.", "Rayner, E.", "Kaldenbach, D.", "Drost, L.", "Dekker, M.", "van Hees-Stuivenberg, S.", "Delzenne-Goette, E.", "de Konink, C.", "Houlleberghs, H.", "Dubbink, H.J.", "AlSaegh, A.", "de Wind, N.", "Forster, F.", "Te Riele, H.", "Sixma, T.K." ], "year": 2023, "year_values": [ 2023 ], "year_conflict": false, "journal": "Nucleic Acids Res.", "doi": "10.1093/nar/gkad015", "pmid": 36715327, "url": "https://doi.org/10.1093/nar/gkad015", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:8AG6:primary", "year": 2023, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1093/nar/gkad015" } ], "proteins": [ { "protein_id": "UP:P52701", "uniprot": "P52701", "gene": "MSH6", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8AG6", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/s41589-021-00898-0", "reference_id": "PMID:34782742", "reference_ids": [ "PMID:34782742" ], "title": "A chemical probe targeting the PWWP domain alters NSD2 nucleolar localization.", "authors": [ "Dilworth D", "Hanley RP", "Ferreira de Freitas R", "Allali-Hassani A", "Zhou M", "Mehta N", "Marunde MR", "Ackloo S", "Carvalho Machado RA", "Khalili Yazdi A", "Owens DDG", "Vu V", "Nie DY", "Alqazzaz M", "Marcon E", "Li F", "Chau I", "Bolotokova A", "Qin S", "Lei M", "Liu Y", "Szewczyk MM", "Dong A", "Kazemzadeh S", "Abramyan T", "Popova IK", "Hall NW", "Meiners MJ", "Cheek MA", "Gibson E", "Kireev D", "Greenblatt JF", "Keogh MC", "Min J", "Brown PJ", "Vedadi M", "Arrowsmith CH", "Barsyte-Lovejoy D", "James LI", "Schapira M" ], "year": 2022, "year_values": [ 2022 ], "year_conflict": false, "journal": "Nature chemical biology", "doi": "10.1038/s41589-021-00898-0", "pmid": 34782742, "url": "https://doi.org/10.1038/s41589-021-00898-0", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "UNC6934 chemical probe and UNC7145 negative control", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:34782742", "year": 2022, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1038/s41589-021-00898-0" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6XCG", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7MDN", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [ { "name": "MRT866", "preparation_id": "PREP:MRT866", "chemical_identity_status": "exact_single_CCD_identity", "assay_ids": [ "PWWP:ASSAY:0003" ], "evidence_classes": [ "direct_binding_affinity" ], "domain_ids": [ "UP:O96028:PWWP1" ] }, { "name": "UNC6934", "preparation_id": "PREP:UNC6934", "chemical_identity_status": "exact_single_CCD_identity", "assay_ids": [ "PWWP:ASSAY:0004", "PWWP:ASSAY:0005", "PWWP:ASSAY:0006" ], "evidence_classes": [ "biochemical_interaction_inhibition", "cellular_interaction_response", "direct_binding_affinity" ], "domain_ids": [ "UP:O96028:PWWP1" ] }, { "name": "UNC7145", "preparation_id": "PREP:UNC7145", "chemical_identity_status": "paper_label_exact_identity_unresolved", "assay_ids": [ "PWWP:ASSAY:0007" ], "evidence_classes": [ "negative_binding_test" ], "domain_ids": [ "UP:O96028:PWWP1" ] } ], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.2210/pdb7v8n/pdb", "reference_id": "PDB:7V8N", "reference_ids": [ "PDB:7V8N" ], "title": "Crystal structure of the PWWP-ARID of ARID4A", "authors": [ "Ren, D.", "Wei, X.", "Lin, L.", "Liu, L.", "Fan, Y.", "Lu, Q.", "He, G." ], "year": 2022, "year_values": [ 2022 ], "year_conflict": false, "journal": null, "doi": "10.2210/pdb7V8N/pdb", "pmid": null, "url": "https://www.rcsb.org/structure/7V8N", "source_type": "experimental_structure_deposition", "citation_role": "pwwp_research_context", "citation_role_label": "Structural deposition record", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Experimental ARID4A PWWP–ARID structure; listed primary article remains To Be Published.", "verification_level": "authoritative_structural_metadata_verified", "source_records": [ { "reference_id": "PDB:7V8N", "year": 2022, "source_type": "experimental_structure_deposition", "verification_level": "authoritative_structural_metadata_verified", "url": "https://www.rcsb.org/structure/7V8N" } ], "proteins": [ { "protein_id": "UP:P29374", "uniprot": "P29374", "gene": "ARID4A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7V8N", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": false }, { "id": "DOI:10.1021/acs.jmedchem.2c00807", "reference_id": "PMID:35895319", "reference_ids": [ "PMID:35895319" ], "title": "Discovery of a First-in-Class Degrader for Nuclear Receptor Binding SET Domain Protein 2 (NSD2) and Ikaros/Aiolos.", "authors": [ "Meng F", "Xu C", "Park KS", "Kaniskan HÜ", "Wang GG", "Jin J" ], "year": 2022, "year_values": [ 2022 ], "year_conflict": false, "journal": "Journal of medicinal chemistry", "doi": "10.1021/acs.jmedchem.2c00807", "pmid": 35895319, "url": "https://doi.org/10.1021/acs.jmedchem.2c00807", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "NSD2 and Ikaros/Aiolos degrader development", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:35895319", "year": 2022, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1021/acs.jmedchem.2c00807" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.ejmech.2022.114528", "reference_id": "PMID:35717870", "reference_ids": [ "PMID:35717870" ], "title": "Discovery of a potent and selective proteolysis targeting chimera (PROTAC) degrader of NSD3 histone methyltransferase.", "authors": [ "Sun Y", "Zhang Y", "Chen X", "Yu A", "Du W", "Huang Y", "Wu F", "Yu L", "Li J", "Wen C", "Yang H", "Shi Q", "Geng M", "Huang X", "Xu S" ], "year": 2022, "year_values": [ 2022 ], "year_conflict": false, "journal": "European journal of medicinal chemistry", "doi": "10.1016/j.ejmech.2022.114528", "pmid": 35717870, "url": "https://doi.org/10.1016/j.ejmech.2022.114528", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "NSD3-targeted PROTAC development; literature-only future-work context", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:35717870", "year": 2022, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.ejmech.2022.114528" } ], "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1093/nar/gkac077", "reference_id": "REF:PDB:7E29:primary", "reference_ids": [ "REF:PDB:7E29:primary" ], "title": "H3K36 methylation and DNA-binding both promote Ioc4 recruitment and Isw1b remodeler function.", "authors": [ "Li, J.", "Bergmann, L.", "Rafael de Almeida, A.", "Webb, K.M.", "Gogol, M.M.", "Voigt, P.", "Liu, Y.", "Liang, H.", "Smolle, M.M." ], "year": 2022, "year_values": [ 2022 ], "year_conflict": false, "journal": "Nucleic Acids Res.", "doi": "10.1093/nar/gkac077", "pmid": 35188579, "url": "https://doi.org/10.1093/nar/gkac077", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:7E29:primary", "year": 2022, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1093/nar/gkac077" } ], "proteins": [ { "protein_id": "UP:Q04213", "uniprot": "Q04213", "gene": "IOC4", "organism": "Saccharomyces cerevisiae (strain ATCC 204508 / S288c)" } ], "structures": [ { "pdb_id": "7E29", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1021/acs.jmedchem.2c00709", "reference_id": "PMID:35704853", "reference_ids": [ "PMID:35704853" ], "title": "Structure-Based Discovery of a Series of NSD2-PWWP1 Inhibitors.", "authors": [ "Li N", "Yang H", "Liu K", "Zhou L", "Huang Y", "Cao D", "Li Y", "Sun Y", "Yu A", "Du Z", "Yu F", "Zhang Y", "Wang B", "Geng M", "Li J", "Xiong B", "Xu S", "Huang X", "Liu T" ], "year": 2022, "year_values": [ 2022 ], "year_conflict": false, "journal": "Journal of medicinal chemistry", "doi": "10.1021/acs.jmedchem.2c00709", "pmid": 35704853, "url": "https://doi.org/10.1021/acs.jmedchem.2c00709", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Structure-based NSD2 PWWP1 inhibitor series", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:35704853", "year": 2022, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1021/acs.jmedchem.2c00709" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7VLN", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.bbagrm.2021.194688", "reference_id": "PMID:33556623", "reference_ids": [ "PMID:33556623" ], "title": "Crystal structure of the BRPF2 PWWP domain in complex with DNA reveals a different binding mode than the HDGF family of PWWP domains.", "authors": [ "Zhang M", "Lei M", "Qin S", "Dong A", "Yang A", "Li Y", "Loppnau P", "Hughes TR", "Min J", "Liu Y" ], "year": 2021, "year_values": [ 2021 ], "year_conflict": false, "journal": "Biochimica et biophysica acta. Gene regulatory mechanisms", "doi": "10.1016/j.bbagrm.2021.194688", "pmid": 33556623, "url": "https://doi.org/10.1016/j.bbagrm.2021.194688", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "BRPF2 PWWP-DNA crystal structure", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:33556623", "year": 2021, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.bbagrm.2021.194688" } ], "proteins": [ { "protein_id": "UP:O95696", "uniprot": "O95696", "gene": "BRD1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7LH9", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1021/acs.jmedchem.0c01768", "reference_id": "PMID:33522809", "reference_ids": [ "PMID:33522809" ], "title": "Discovery of Small-Molecule Antagonists of the PWWP Domain of NSD2.", "authors": [ "Ferreira de Freitas R", "Liu Y", "Szewczyk MM", "Mehta N", "Li F", "McLeod D", "Zepeda-Velázquez C", "Dilworth D", "Hanley RP", "Gibson E", "Brown PJ", "Al-Awar R", "James LI", "Arrowsmith CH", "Barsyte-Lovejoy D", "Min J", "Vedadi M", "Schapira M", "Allali-Hassani A" ], "year": 2021, "year_values": [ 2021 ], "year_conflict": false, "journal": "Journal of medicinal chemistry", "doi": "10.1021/acs.jmedchem.0c01768", "pmid": 33522809, "url": "https://doi.org/10.1021/acs.jmedchem.0c01768", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "MRT837 and NSD2 PWWP1 small-molecule antagonists", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:33522809", "year": 2021, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1021/acs.jmedchem.0c01768" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6UE6", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [ { "name": "MR837 (3f)", "preparation_id": "PREP:MR837", "chemical_identity_status": "exact_single_CCD_identity", "assay_ids": [ "PWWP:ASSAY:0001", "PWWP:ASSAY:0002" ], "evidence_classes": [ "direct_binding_affinity" ], "domain_ids": [ "UP:O96028:PWWP1" ] } ], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.bbrc.2021.07.017", "reference_id": "PMID:34271259", "reference_ids": [ "PMID:34271259" ], "title": "Histone and DNA binding ability studies of the NSD subfamily of PWWP domains.", "authors": [ "Zhang M", "Yang Y", "Zhou M", "Dong A", "Yan X", "Loppnau P", "Min J", "Liu Y" ], "year": 2021, "year_values": [ 2021 ], "year_conflict": false, "journal": "Biochemical and biophysical research communications", "doi": "10.1016/j.bbrc.2021.07.017", "pmid": 34271259, "url": "https://doi.org/10.1016/j.bbrc.2021.07.017", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "NSD-family PWWP histone and DNA-binding comparison", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:34271259", "year": 2021, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.bbrc.2021.07.017" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" }, { "protein_id": "UP:Q96L73", "uniprot": "Q96L73", "gene": "NSD1", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4RXJ", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "5VC8", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/s41586-020-03069-8", "reference_id": "REF:PDB:7CRO:primary", "reference_ids": [ "REF:PDB:7CRO:primary" ], "title": "Molecular basis of nucleosomal H3K36 methylation by NSD methyltransferases.", "authors": [ "Li, W.", "Tian, W.", "Yuan, G.", "Deng, P.", "Sengupta, D.", "Cheng, Z.", "Cao, Y.", "Ren, J.", "Qin, Y.", "Zhou, Y.", "Jia, Y.", "Gozani, O.", "Patel, D.J.", "Wang, Z." ], "year": 2021, "year_values": [ 2021 ], "year_conflict": false, "journal": "Nature", "doi": "10.1038/s41586-020-03069-8", "pmid": 33361816, "url": "https://doi.org/10.1038/s41586-020-03069-8", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:7CRO:primary", "year": 2021, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1038/s41586-020-03069-8" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7CRO", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "7CRP", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "7CRQ", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "7CRR", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.jmb.2021.167224", "reference_id": "PMID:34506790", "reference_ids": [ "PMID:34506790" ], "title": "Structural Insight into Chromatin Recognition by Multiple Domains of the Tumor Suppressor RBBP1.", "authors": [ "Gong W", "Liang Q", "Tong Y", "Perrett S", "Feng Y" ], "year": 2021, "year_values": [ 2021 ], "year_conflict": false, "journal": "Journal of molecular biology", "doi": "10.1016/j.jmb.2021.167224", "pmid": 34506790, "url": "https://doi.org/10.1016/j.jmb.2021.167224", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Experimental solution structure of engineered tandem PWWP–ARID; PDB 6L87", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:34506790", "year": 2021, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1016/j.jmb.2021.167224" } ], "proteins": [ { "protein_id": "UP:P29374", "uniprot": "P29374", "gene": "ARID4A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6L87", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/s41467-021-25284-1", "reference_id": "REF:PDB:7OUF:primary", "reference_ids": [ "REF:PDB:7OUF:primary" ], "title": "Structural basis for the inhibition of HTLV-1 integration inferred from cryo-EM deltaretroviral intasome structures.", "authors": [ "Barski, M.S.", "Vanzo, T.", "Zhao, X.Z.", "Smith, S.J.", "Ballandras-Colas, A.", "Cronin, N.B.", "Pye, V.E.", "Hughes, S.H.", "Burke Jr., T.R.", "Cherepanov, P.", "Maertens, G.N." ], "year": 2021, "year_values": [ 2021 ], "year_conflict": false, "journal": "Nat Commun", "doi": "10.1038/s41467-021-25284-1", "pmid": 34404793, "url": "https://doi.org/10.1038/s41467-021-25284-1", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:7OUF:primary", "year": 2021, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1038/s41467-021-25284-1" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7OUF", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "7OUG", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "7OUH", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/s41467-020-18874-y", "reference_id": "REF:PDB:7PEL:primary", "reference_ids": [ "REF:PDB:7PEL:primary" ], "title": "Cryo-EM structure of the deltaretroviral intasome in complex with the PP2A regulatory subunit B56gamma.", "authors": [ "Barski, M.S.", "Minnell, J.J.", "Hodakova, Z.", "Pye, V.E.", "Nans, A.", "Cherepanov, P.", "Maertens, G.N." ], "year": 2020, "year_values": [ 2020 ], "year_conflict": false, "journal": "Nat Commun", "doi": "10.1038/s41467-020-18874-y", "pmid": 33028863, "url": "https://doi.org/10.1038/s41467-020-18874-y", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:7PEL:primary", "year": 2020, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1038/s41467-020-18874-y" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7PEL", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/s41594-019-0345-4", "reference_id": "PMID:31819277", "reference_ids": [ "PMID:31819277" ], "title": "Structure of H3K36-methylated nucleosome-PWWP complex reveals multivalent cross-gyre binding.", "authors": [ "Wang H", "Farnung L", "Dienemann C", "Cramer P" ], "year": 2020, "year_values": [ 2020 ], "year_conflict": false, "journal": "Nature structural & molecular biology", "doi": "10.1038/s41594-019-0345-4", "pmid": 31819277, "url": "https://doi.org/10.1038/s41594-019-0345-4", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP-nucleosome cryo-EM structure and cross-gyre DNA binding", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:31819277", "year": 2020, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1038/s41594-019-0345-4" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6S01", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/s41586-020-2747-1", "reference_id": "PMID:32968275", "reference_ids": [ "PMID:32968275" ], "title": "Structure of nucleosome-bound DNA methyltransferases DNMT3A and DNMT3B.", "authors": [ "Xu TH", "Liu M", "Zhou XE", "Liang G", "Zhao G", "Xu HE", "Melcher K", "Jones PA" ], "year": 2020, "year_values": [ 2020 ], "year_conflict": false, "journal": "Nature", "doi": "10.1038/s41586-020-2747-1", "pmid": 32968275, "url": "https://doi.org/10.1038/s41586-020-2747-1", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "DNMT3A2-DNMT3B3-nucleosome cryo-EM context; PWWP coordinate inclusion must be checked", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:32968275", "year": 2020, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1038/s41586-020-2747-1" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6PA7", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "REF:PDB:6IIP:primary", "reference_id": "REF:PDB:6IIP:primary", "reference_ids": [ "REF:PDB:6IIP:primary" ], "title": "Apo-form structure of the HRP3 PWWP domain", "authors": [ "Wang, Z.", "Tian, W." ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Nucleic Acids Res.", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/6IIP", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:6IIP:primary", "year": 2019, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/6IIP" } ], "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIP", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "REF:PDB:6IIR:primary", "reference_id": "REF:PDB:6IIR:primary", "reference_ids": [ "REF:PDB:6IIR:primary" ], "title": "Complex structure of the HRP3 PWWP domain with a 10-bp GC-rich DNA", "authors": [ "Wang, Z.", "Tian, W." ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Nucleic Acids Res.", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/6IIR", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:6IIR:primary", "year": 2019, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/6IIR" } ], "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIR", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "REF:PDB:6IIQ:primary", "reference_id": "REF:PDB:6IIQ:primary", "reference_ids": [ "REF:PDB:6IIQ:primary" ], "title": "Complex structure of the HRP3 PWWP domain with a 16-bp TA-rich DNA", "authors": [ "Wang, Z.", "Tian, W." ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Nucleic Acids Res.", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/6IIQ", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:6IIQ:primary", "year": 2019, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/6IIQ" } ], "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIQ", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "REF:PDB:6IIT:primary", "reference_id": "REF:PDB:6IIT:primary", "reference_ids": [ "REF:PDB:6IIT:primary" ], "title": "Complex structure of the HRP3 PWWP domain with both a 16-bp TA-rich DNA and a H3K36me2-containing histone peptide", "authors": [ "Wang, Z.", "Tian, W." ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Nucleic Acids Res.", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/6IIT", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:6IIT:primary", "year": 2019, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/6IIT" } ], "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIT", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "REF:PDB:6IIS:primary", "reference_id": "REF:PDB:6IIS:primary", "reference_ids": [ "REF:PDB:6IIS:primary" ], "title": "Complex structure of the HRP3 PWWP domain with both a 16-bp TA-rich DNA and an H3K36me3-containing histone peptide", "authors": [ "Wang, Z.", "Tian, W." ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Nucleic Acids Res.", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/6IIS", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:6IIS:primary", "year": 2019, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/6IIS" } ], "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIS", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/s41589-019-0310-x", "reference_id": "PMID:31285596", "reference_ids": [ "PMID:31285596" ], "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "authors": [ "Böttcher J", "Dilworth D", "Reiser U", "Neumüller RA", "Schleicher M", "Petronczki M", "Zeeb M", "Mischerikow N", "Allali-Hassani A", "Szewczyk MM", "Li F", "Kennedy S", "Vedadi M", "Barsyte-Lovejoy D", "Brown PJ", "Huber KVM", "Rogers CM", "Wells CI", "Fedorov O", "Rumpel K", "Zoephel A", "Mayer M", "Wunberg T", "Böse D", "Zahn S", "Arnhof H", "Berger H", "Reiser C", "Hörmann A", "Krammer T", "Corcokovic M", "Sharps B", "Winkler S", "Häring D", "Cockcroft XL", "Fuchs JE", "Müllauer B", "Weiss-Puxbaum A", "Gerstberger T", "Boehmelt G", "Vakoc CR", "Arrowsmith CH", "Pearson M", "McConnell DB" ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Nature chemical biology", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "url": "https://doi.org/10.1038/s41589-019-0310-x", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "BI-9321 PWWP1 chemical probe and fragment-to-probe development", "verification_level": "primary_data_availability_and_developer_assays_verified", "source_records": [ { "reference_id": "PMID:31285596", "year": 2019, "source_type": "primary_experimental_research", "verification_level": "primary_data_availability_and_developer_assays_verified", "url": "https://doi.org/10.1038/s41589-019-0310-x" } ], "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G24", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G25", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G27", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G29", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G2B", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G2C", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G2E", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G2F", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G2O", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G3P", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G3T", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [ { "name": "BI-9321", "preparation_id": "PREP:BI-9321", "chemical_identity_status": "exact_single_CCD_identity", "assay_ids": [ "PWWP:ASSAY:0008", "PWWP:ASSAY:0009" ], "evidence_classes": [ "cellular_interaction_response", "direct_binding_affinity" ], "domain_ids": [ "UP:Q9BZ95:PWWP1" ] } ], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.jmb.2019.09.006", "reference_id": "PMID:31634469", "reference_ids": [ "PMID:31634469" ], "title": "H3K36me2/3 Binding and DNA Binding of the DNA Methyltransferase DNMT3A PWWP Domain Both Contribute to its Chromatin Interaction.", "authors": [ "Dukatz M", "Holzer K", "Choudalakis M", "Emperle M", "Lungu C", "Bashtrykov P", "Jeltsch A" ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Journal of molecular biology", "doi": "10.1016/j.jmb.2019.09.006", "pmid": 31634469, "url": "https://doi.org/10.1016/j.jmb.2019.09.006", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "DNA and H3K36me2/3 contributions to DNMT3A PWWP chromatin interaction", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:31634469", "year": 2019, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.jmb.2019.09.006" } ], "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1126/sciadv.aay3068", "reference_id": "PMID:31616795", "reference_ids": [ "PMID:31616795" ], "title": "LEDGF and HDGF2 relieve the nucleosome-induced barrier to transcription in differentiated cells.", "authors": [ "LeRoy G", "Oksuz O", "Descostes N", "Aoi Y", "Ganai RA", "Kara HO", "Yu JR", "Lee CH", "Stafford J", "Shilatifard A", "Reinberg D" ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Science advances", "doi": "10.1126/sciadv.aay3068", "pmid": 31616795, "url": "https://doi.org/10.1126/sciadv.aay3068", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "LEDGF and HDGF2 nucleosome-dependent transcription", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "source_records": [ { "reference_id": "PMID:31616795", "year": 2019, "source_type": "primary_experimental_research", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "url": "https://doi.org/10.1126/sciadv.aay3068" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" }, { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1107/s2059798319011471", "reference_id": "REF:PDB:29HG:1", "reference_ids": [ "REF:PDB:29HG:1" ], "title": "Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix", "authors": [ "Liebschner, D.", "Afonine, P.V.", "Baker, M.L.", "Bunkoczi, G.", "Chen, V.B.", "Croll, T.I.", "Hintze, B.", "Hung, L.W.", "Jain, S.", "McCoy, A.J.", "Moriarty, N.W.", "Oeffner, R.D.", "Poon, B.K.", "Prisant, M.G.", "Read, R.J.", "Richardson, J.S.", "Richardson, D.C.", "Sammito, M.D.", "Sobolev, O.V.", "Stockwell, D.H.", "Terwilliger, T.C.", "Urzhumtsev, A.G.", "Videau, L.L.", "Williams, C.J.", "Adams, P.D." ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Acta Crystallogr., Sect. D: Biol. Crystallogr.", "doi": "10.1107/S2059798319011471", "pmid": 31588918, "url": "https://doi.org/10.1107/S2059798319011471", "source_type": "experimental_deposition_bibliography", "citation_role": "methodological_context", "citation_role_label": "Methodological citation · not a PWWP finding", "citation_role_basis": "The recorded title identifies Phenix structure-determination methodology; REF:PDB:29HG:1 is a supporting deposition citation, not its primary PWWP article.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:29HG:1", "year": 2019, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1107/S2059798319011471" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "29HG", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "29HH", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "29HI", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1007/s12104-019-09873-2", "reference_id": "PMID:30666492", "reference_ids": [ "PMID:30666492" ], "title": "Resonance assignments for the tandem PWWP-ARID domains of human RBBP1.", "authors": [ "Gong W", "Yao X", "Liang Q", "Tong Y", "Perrett S", "Feng Y" ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Biomolecular NMR assignments", "doi": "10.1007/s12104-019-09873-2", "pmid": 30666492, "url": "https://doi.org/10.1007/s12104-019-09873-2", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "NMR resonance assignments of human RBBP1 tandem PWWP-ARID; assignment report distinguished from structure determination", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:30666492", "year": 2019, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1007/s12104-019-09873-2" } ], "proteins": [ { "protein_id": "UP:P29374", "uniprot": "P29374", "gene": "ARID4A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1042/bcj20180870", "reference_id": "PMID:30626613", "reference_ids": [ "PMID:30626613" ], "title": "Solution structure of TbTFIIS2-2 PWWP domain from Trypanosoma brucei and its binding to H4K17me3 and H3K32me3.", "authors": [ "Wang R", "Gao J", "Zhang J", "Zhang X", "Xu C", "Liao S", "Tu X" ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "The Biochemical journal", "doi": "10.1042/bcj20180870", "pmid": 30626613, "url": "https://doi.org/10.1042/bcj20180870", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Trypanosoma PWWP solution structure and methylhistone binding", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:30626613", "year": 2019, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1042/bcj20180870" } ], "proteins": [], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1093/nar/gkz294", "reference_id": "PMID:31162607", "reference_ids": [ "PMID:31162607" ], "title": "The HRP3 PWWP domain recognizes the minor groove of double-stranded DNA and recruits HRP3 to chromatin.", "authors": [ "Tian W", "Yan P", "Xu N", "Chakravorty A", "Liefke R", "Xi Q", "Wang Z" ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Nucleic acids research", "doi": "10.1093/nar/gkz294", "pmid": 31162607, "url": "https://doi.org/10.1093/nar/gkz294", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "HRP3 PWWP recognition of DNA minor groove", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:31162607", "year": 2019, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1093/nar/gkz294" } ], "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIP", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6IIQ", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6IIR", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6IIS", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6IIT", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/s41467-018-06235-9", "reference_id": "PMID:30228260", "reference_ids": [ "PMID:30228260" ], "title": "A variant NuRD complex containing PWWP2A/B excludes MBD2/3 to regulate transcription at active genes.", "authors": [ "Zhang T", "Wei G", "Millard CJ", "Fischer R", "Konietzny R", "Kessler BM", "Schwabe JWR", "Brockdorff N" ], "year": 2018, "year_values": [ 2018 ], "year_conflict": false, "journal": "Nature communications", "doi": "10.1038/s41467-018-06235-9", "pmid": 30228260, "url": "https://doi.org/10.1038/s41467-018-06235-9", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP2A/B variant NuRD complexes at active genes", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "source_records": [ { "reference_id": "PMID:30228260", "year": 2018, "source_type": "primary_experimental_research", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "url": "https://doi.org/10.1038/s41467-018-06235-9" } ], "proteins": [ { "protein_id": "UP:Q6NUJ5", "uniprot": "Q6NUJ5", "gene": "PWWP2B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q96N64", "uniprot": "Q96N64", "gene": "PWWP2A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/s41598-017-18510-8", "reference_id": "PMID:29321480", "reference_ids": [ "PMID:29321480" ], "title": "Domain swapping and SMYD1 interactions with the PWWP domain of human hepatoma-derived growth factor.", "authors": [ "Chen LY", "Huang YC", "Huang ST", "Hsieh YC", "Guan HH", "Chen NC", "Chuankhayan P", "Yoshimura M", "Tai MH", "Chen CJ" ], "year": 2018, "year_values": [ 2018 ], "year_conflict": false, "journal": "Scientific reports", "doi": "10.1038/s41598-017-18510-8", "pmid": 29321480, "url": "https://doi.org/10.1038/s41598-017-18510-8", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "HDGF domain swapping and SMYD1 interaction", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:29321480", "year": 2018, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1038/s41598-017-18510-8" } ], "proteins": [ { "protein_id": "UP:P51858", "uniprot": "P51858", "gene": "HDGF", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5XSK", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "5XSL", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/s41467-018-06665-5", "reference_id": "PMID:30327463", "reference_ids": [ "PMID:30327463" ], "title": "PWWP2A binds distinct chromatin moieties and interacts with an MTA1-specific core NuRD complex.", "authors": [ "Link S", "Spitzer RMM", "Sana M", "Torrado M", "Völker-Albert MC", "Keilhauer EC", "Burgold T", "Pünzeler S", "Low JKK", "Lindström I", "Nist A", "Regnard C", "Stiewe T", "Hendrich B", "Imhof A", "Mann M", "Mackay JP", "Bartkuhn M", "Hake SB" ], "year": 2018, "year_values": [ 2018 ], "year_conflict": false, "journal": "Nature communications", "doi": "10.1038/s41467-018-06665-5", "pmid": 30327463, "url": "https://doi.org/10.1038/s41467-018-06665-5", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP2A chromatin contacts and MTA1-specific NuRD; modeled PWWP structure is not experimental", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:30327463", "year": 2018, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1038/s41467-018-06665-5" } ], "proteins": [ { "protein_id": "UP:Q96N64", "uniprot": "Q96N64", "gene": "PWWP2A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.15252/embj.201695757", "reference_id": "PMID:28645917", "reference_ids": [ "PMID:28645917" ], "title": "Multivalent binding of PWWP2A to H2A.Z regulates mitosis and neural crest differentiation.", "authors": [ "Pünzeler S", "Link S", "Wagner G", "Keilhauer EC", "Kronbeck N", "Spitzer RM", "Leidescher S", "Markaki Y", "Mentele E", "Regnard C", "Schneider K", "Takahashi D", "Kusakabe M", "Vardabasso C", "Zink LM", "Straub T", "Bernstein E", "Harata M", "Leonhardt H", "Mann M", "Rupp RA", "Hake SB" ], "year": 2017, "year_values": [ 2017 ], "year_conflict": false, "journal": "The EMBO journal", "doi": "10.15252/embj.201695757", "pmid": 28645917, "url": "https://doi.org/10.15252/embj.201695757", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP2A multivalent H2A.Z nucleosome binding", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:28645917", "year": 2017, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.15252/embj.201695757" } ], "proteins": [ { "protein_id": "UP:Q96N64", "uniprot": "Q96N64", "gene": "PWWP2A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.str.2017.08.014", "reference_id": "PMID:28966017", "reference_ids": [ "PMID:28966017" ], "title": "The Structure of the ZMYND8/Drebrin Complex Suggests a Cytoplasmic Sequestering Mechanism of ZMYND8 by Drebrin.", "authors": [ "Yao N", "Li J", "Liu H", "Wan J", "Liu W", "Zhang M" ], "year": 2017, "year_values": [ 2017 ], "year_conflict": false, "journal": "Structure (London, England : 1993)", "doi": "10.1016/j.str.2017.08.014", "pmid": 28966017, "url": "https://doi.org/10.1016/j.str.2017.08.014", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "ZMYND8-drebrin structural interaction", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:28966017", "year": 2017, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.str.2017.08.014" } ], "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5Y1Z", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1074/jbc.m116.720748", "reference_id": "PMID:26912663", "reference_ids": [ "PMID:26912663" ], "title": "A PWWP Domain of Histone-Lysine N-Methyltransferase NSD2 Binds to Dimethylated Lys-36 of Histone H3 and Regulates NSD2 Function at Chromatin.", "authors": [ "Sankaran SM", "Wilkinson AW", "Elias JE", "Gozani O" ], "year": 2016, "year_values": [ 2016 ], "year_conflict": false, "journal": "The Journal of biological chemistry", "doi": "10.1074/jbc.m116.720748", "pmid": 26912663, "url": "https://doi.org/10.1074/jbc.m116.720748", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "NSD2 PWWP recognition of H3K36me2 and chromatin recruitment", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:26912663", "year": 2016, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1074/jbc.m116.720748" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.celrep.2016.11.014", "reference_id": "PMID:27926874", "reference_ids": [ "PMID:27926874" ], "title": "Multivalent Histone and DNA Engagement by a PHD/BRD/PWWP Triple Reader Cassette Recruits ZMYND8 to K14ac-Rich Chromatin.", "authors": [ "Savitsky P", "Krojer T", "Fujisawa T", "Lambert JP", "Picaud S", "Wang CY", "Shanle EK", "Krajewski K", "Friedrichsen H", "Kanapin A", "Goding C", "Schapira M", "Samsonova A", "Strahl BD", "Gingras AC", "Filippakopoulos P" ], "year": 2016, "year_values": [ 2016 ], "year_conflict": false, "journal": "Cell reports", "doi": "10.1016/j.celrep.2016.11.014", "pmid": 27926874, "url": "https://doi.org/10.1016/j.celrep.2016.11.014", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PHD-BRD-PWWP cassette multivalent histone and DNA engagement", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:27926874", "year": 2016, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1016/j.celrep.2016.11.014" } ], "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4COS", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1007/s12551-015-0190-6", "reference_id": "PMID:28510146", "reference_ids": [ "PMID:28510146" ], "title": "PWWP domains and their modes of sensing DNA and histone methylated lysines.", "authors": [ "Rona GB", "Eleutherio ECA", "Pinheiro AS" ], "year": 2016, "year_values": [ 2016 ], "year_conflict": false, "journal": "Biophysical reviews", "doi": "10.1007/s12551-015-0190-6", "pmid": 28510146, "url": "https://doi.org/10.1007/s12551-015-0190-6", "source_type": "review", "citation_role": "pwwp_research_context", "citation_role_label": "Review / synthesis", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP DNA and methyllysine recognition review", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:28510146", "year": 2016, "source_type": "review", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1007/s12551-015-0190-6" } ], "proteins": [], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1074/jbc.m115.679985", "reference_id": "PMID:26655721", "reference_ids": [ "PMID:26655721" ], "title": "Selective Recognition of H3.1K36 Dimethylation/H4K16 Acetylation Facilitates the Regulation of All-trans-retinoic Acid (ATRA)-responsive Genes by Putative Chromatin Reader ZMYND8.", "authors": [ "Adhikary S", "Sanyal S", "Basu M", "Sengupta I", "Sen S", "Srivastava DK", "Roy S", "Das C" ], "year": 2016, "year_values": [ 2016 ], "year_conflict": false, "journal": "The Journal of biological chemistry", "doi": "10.1074/jbc.m115.679985", "pmid": 26655721, "url": "https://doi.org/10.1074/jbc.m115.679985", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Combinatorial histone recognition by ZMYND8", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:26655721", "year": 2016, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1074/jbc.m115.679985" } ], "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1002/prot.25035", "reference_id": "PMID:27005948", "reference_ids": [ "PMID:27005948" ], "title": "Solution structure of TbTFIIS2-1 PWWP domain from Trypanosoma brucei.", "authors": [ "Wang R", "Zhang J", "Liao S", "Tu X" ], "year": 2016, "year_values": [ 2016 ], "year_conflict": false, "journal": "Proteins", "doi": "10.1002/prot.25035", "pmid": 27005948, "url": "https://doi.org/10.1002/prot.25035", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Trypanosoma brucei PWWP solution structure", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:27005948", "year": 2016, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1002/prot.25035" } ], "proteins": [], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.jsb.2016.03.013", "reference_id": "PMID:26993463", "reference_ids": [ "PMID:26993463" ], "title": "Structural basis for recognition of histone H3K36me3 nucleosome by human de novo DNA methyltransferases 3A and 3B.", "authors": [ "Rondelet G", "Dal Maso T", "Willems L", "Wouters J" ], "year": 2016, "year_values": [ 2016 ], "year_conflict": false, "journal": "Journal of structural biology", "doi": "10.1016/j.jsb.2016.03.013", "pmid": 26993463, "url": "https://doi.org/10.1016/j.jsb.2016.03.013", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "DNMT3B PWWP-H3K36me3 crystal structures and nucleosome recognition", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:26993463", "year": 2016, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.jsb.2016.03.013" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5CIU", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.molcel.2016.06.035", "reference_id": "REF:PDB:5B73:primary", "reference_ids": [ "REF:PDB:5B73:primary" ], "title": "ZMYND8 Reads the Dual Histone Mark H3K4me1-H3K14ac to Antagonize the Expression of Metastasis-Linked Genes", "authors": [ "Li, N.", "Li, Y.", "Lv, J.", "Zheng, X.", "Wen, H.", "Shen, H.", "Zhu, G.", "Chen, T.Y.", "Dhar, S.S.", "Kan, P.Y.", "Wang, Z.", "Shiekhattar, R.", "Shi, X.", "Lan, F.", "Chen, K.", "Li, W.", "Li, H.", "Lee, M.G." ], "year": 2016, "year_values": [ 2016 ], "year_conflict": false, "journal": "Mol.Cell", "doi": "10.1016/j.molcel.2016.06.035", "pmid": 27477906, "url": "https://doi.org/10.1016/j.molcel.2016.06.035", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:5B73:primary", "year": 2016, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1016/j.molcel.2016.06.035" } ], "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5B73", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1021/acs.biochem.5b00454", "reference_id": "PMID:26067205", "reference_ids": [ "PMID:26067205" ], "title": "The First Residue of the PWWP Motif Modulates HATH Domain Binding, Stability, and Protein-Protein Interaction.", "authors": [ "Hung YL", "Lee HJ", "Jiang I", "Lin SC", "Lo WC", "Lin YJ", "Sue SC" ], "year": 2015, "year_values": [ 2015 ], "year_conflict": false, "journal": "Biochemistry", "doi": "10.1021/acs.biochem.5b00454", "pmid": 26067205, "url": "https://doi.org/10.1021/acs.biochem.5b00454", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP motif first-residue contribution to HATH binding and stability", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:26067205", "year": 2015, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1021/acs.biochem.5b00454" } ], "proteins": [ { "protein_id": "UP:P51858", "uniprot": "P51858", "gene": "HDGF", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1074/mcp.m114.038224", "reference_id": "PMID:25104842", "reference_ids": [ "PMID:25104842" ], "title": "A PWWP domain-containing protein targets the NuA3 acetyltransferase complex via histone H3 lysine 36 trimethylation to coordinate transcriptional elongation at coding regions.", "authors": [ "Gilbert TM", "McDaniel SL", "Byrum SD", "Cades JA", "Dancy BC", "Wade H", "Tackett AJ", "Strahl BD", "Taverna SD" ], "year": 2014, "year_values": [ 2014 ], "year_conflict": false, "journal": "Molecular & cellular proteomics : MCP", "doi": "10.1074/mcp.m114.038224", "pmid": 25104842, "url": "https://doi.org/10.1074/mcp.m114.038224", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Yeast PWWP targeting of NuA3 to H3K36me3", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:25104842", "year": 2014, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1074/mcp.m114.038224" } ], "proteins": [], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.molcel.2014.08.022", "reference_id": "PMID:25263594", "reference_ids": [ "PMID:25263594" ], "title": "BS69/ZMYND11 reads and connects histone H3.3 lysine 36 trimethylation-decorated chromatin to regulated pre-mRNA processing.", "authors": [ "Guo R", "Zheng L", "Park JW", "Lv R", "Chen H", "Jiao F", "Xu W", "Mu S", "Wen H", "Qiu J", "Wang Z", "Yang P", "Wu F", "Hui J", "Fu X", "Shi X", "Shi YG", "Xing Y", "Lan F", "Shi Y" ], "year": 2014, "year_values": [ 2014 ], "year_conflict": false, "journal": "Molecular cell", "doi": "10.1016/j.molcel.2014.08.022", "pmid": 25263594, "url": "https://doi.org/10.1016/j.molcel.2014.08.022", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Histone H3.3 recognition coupled to pre-mRNA processing", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:25263594", "year": 2014, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.molcel.2014.08.022" } ], "proteins": [ { "protein_id": "UP:Q15326", "uniprot": "Q15326", "gene": "ZMYND11", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/cr.2014.38", "reference_id": "PMID:24675531", "reference_ids": [ "PMID:24675531" ], "title": "Crystal structure of human BS69 Bromo-ZnF-PWWP reveals its role in H3K36me3 nucleosome binding.", "authors": [ "Wang J", "Qin S", "Li F", "Li S", "Zhang W", "Peng J", "Zhang Z", "Gong Q", "Wu J", "Shi Y" ], "year": 2014, "year_values": [ 2014 ], "year_conflict": false, "journal": "Cell research", "doi": "10.1038/cr.2014.38", "pmid": 24675531, "url": "https://doi.org/10.1038/cr.2014.38", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "BS69 Bromo-ZnF-PWWP structure and nucleosome recognition", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:24675531", "year": 2014, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1038/cr.2014.38" } ], "proteins": [ { "protein_id": "UP:Q15326", "uniprot": "Q15326", "gene": "ZMYND11", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4NS5", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.tibs.2014.09.001", "reference_id": "PMID:25277115", "reference_ids": [ "PMID:25277115" ], "title": "Structure and function of the nucleosome-binding PWWP domain.", "authors": [ "Qin S", "Min J" ], "year": 2014, "year_values": [ 2014 ], "year_conflict": false, "journal": "Trends in biochemical sciences", "doi": "10.1016/j.tibs.2014.09.001", "pmid": 25277115, "url": "https://doi.org/10.1016/j.tibs.2014.09.001", "source_type": "review", "citation_role": "pwwp_research_context", "citation_role_label": "Review / synthesis", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Nucleosome-binding PWWP domain review", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:25277115", "year": 2014, "source_type": "review", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.tibs.2014.09.001" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4FU6", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/nature13045", "reference_id": "PMID:24590075", "reference_ids": [ "PMID:24590075" ], "title": "ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression.", "authors": [ "Wen H", "Li Y", "Xi Y", "Jiang S", "Stratton S", "Peng D", "Tanaka K", "Ren Y", "Xia Z", "Wu J", "Li B", "Barton MC", "Li W", "Li H", "Shi X" ], "year": 2014, "year_values": [ 2014 ], "year_conflict": false, "journal": "Nature", "doi": "10.1038/nature13045", "pmid": 24590075, "url": "https://doi.org/10.1038/nature13045", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Histone variant H3.3K36me3 recognition and tumor suppression", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:24590075", "year": 2014, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1038/nature13045" } ], "proteins": [ { "protein_id": "UP:Q15326", "uniprot": "Q15326", "gene": "ZMYND11", "organism": "Homo sapiens" }, { "protein_id": "UP:Q8R5C8", "uniprot": "Q8R5C8", "gene": "Zmynd11", "organism": "Mus musculus" } ], "structures": [ { "pdb_id": "4N4G", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "4N4H", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "4N4I", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1186/1756-8935-6-12", "reference_id": "PMID:23656834", "reference_ids": [ "PMID:23656834" ], "title": "Nucleosomal DNA binding drives the recognition of H3K36-methylated nucleosomes by the PSIP1-PWWP domain.", "authors": [ "van Nuland R", "van Schaik FM", "Simonis M", "van Heesch S", "Cuppen E", "Boelens R", "Timmers HM", "van Ingen H" ], "year": 2013, "year_values": [ 2013 ], "year_conflict": false, "journal": "Epigenetics & chromatin", "doi": "10.1186/1756-8935-6-12", "pmid": 23656834, "url": "https://doi.org/10.1186/1756-8935-6-12", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Nucleosomal DNA contribution to PSIP1 PWWP recognition", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:23656834", "year": 2013, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1186/1756-8935-6-12" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3ZEH", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3ZH1", "in_atlas": false, "observed_pwwp": null } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1093/nar/gkt074", "reference_id": "PMID:23396443", "reference_ids": [ "PMID:23396443" ], "title": "Structural basis for high-affinity binding of LEDGF PWWP to mononucleosomes.", "authors": [ "Eidahl JO", "Crowe BL", "North JA", "McKee CJ", "Shkriabai N", "Feng L", "Plumb M", "Graham RL", "Gorelick RJ", "Hess S", "Poirier MG", "Foster MP", "Kvaratskhelia M" ], "year": 2013, "year_values": [ 2013 ], "year_conflict": false, "journal": "Nucleic acids research", "doi": "10.1093/nar/gkt074", "pmid": 23396443, "url": "https://doi.org/10.1093/nar/gkt074", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "LEDGF PWWP solution structure and cooperative nucleosome recognition", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:23396443", "year": 2013, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1093/nar/gkt074" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2M16", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1371/journal.pone.0081217", "reference_id": "PMID:24312278", "reference_ids": [ "PMID:24312278" ], "title": "TOX4 and NOVA1 proteins are partners of the LEDGF PWWP domain and affect HIV-1 replication.", "authors": [ "Morchikh M", "Naughtin M", "Di Nunzio F", "Xavier J", "Charneau P", "Jacob Y", "Lavigne M" ], "year": 2013, "year_values": [ 2013 ], "year_conflict": false, "journal": "PloS one", "doi": "10.1371/journal.pone.0081217", "pmid": 24312278, "url": "https://doi.org/10.1371/journal.pone.0081217", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "TOX4 and NOVA1 as LEDGF PWWP interaction partners", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "source_records": [ { "reference_id": "PMID:24312278", "year": 2013, "source_type": "primary_experimental_research", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "url": "https://doi.org/10.1371/journal.pone.0081217" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.cell.2013.03.025", "reference_id": "PMID:23622243", "reference_ids": [ "PMID:23622243" ], "title": "The histone mark H3K36me3 regulates human DNA mismatch repair through its interaction with MutSα.", "authors": [ "Li F", "Mao G", "Tong D", "Huang J", "Gu L", "Yang W", "Li GM" ], "year": 2013, "year_values": [ 2013 ], "year_conflict": false, "journal": "Cell", "doi": "10.1016/j.cell.2013.03.025", "pmid": 23622243, "url": "https://doi.org/10.1016/j.cell.2013.03.025", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "H3K36me3 recognition and human mismatch repair", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:23622243", "year": 2013, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.cell.2013.03.025" } ], "proteins": [ { "protein_id": "UP:P52701", "uniprot": "P52701", "gene": "MSH6", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1186/1471-2148-12-101", "reference_id": "PMID:22734652", "reference_ids": [ "PMID:22734652" ], "title": "Evolution of the PWWP-domain encoding genes in the plant and animal lineages.", "authors": [ "Alvarez-Venegas R", "Avramova Z" ], "year": 2012, "year_values": [ 2012 ], "year_conflict": false, "journal": "BMC evolutionary biology", "doi": "10.1186/1471-2148-12-101", "pmid": 22734652, "url": "https://doi.org/10.1186/1471-2148-12-101", "source_type": "primary_sequence_analysis", "citation_role": "pwwp_research_context", "citation_role_label": "Comparative sequence research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Comparative evolution of PWWP-domain genes in animal and plant lineages", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "source_records": [ { "reference_id": "PMID:22734652", "year": 2012, "source_type": "primary_sequence_analysis", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "url": "https://doi.org/10.1186/1471-2148-12-101" } ], "proteins": [], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1042/bj20111885", "reference_id": "PMID:22150589", "reference_ids": [ "PMID:22150589" ], "title": "Solution structure of the Pdp1 PWWP domain reveals its unique binding sites for methylated H4K20 and DNA.", "authors": [ "Qiu Y", "Zhang W", "Zhao C", "Wang Y", "Wang W", "Zhang J", "Zhang Z", "Li G", "Shi Y", "Tu X", "Wu J" ], "year": 2012, "year_values": [ 2012 ], "year_conflict": false, "journal": "The Biochemical journal", "doi": "10.1042/bj20111885", "pmid": 22150589, "url": "https://doi.org/10.1042/bj20111885", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Pdp1 PWWP solution structure and H4K20/DNA binding sites", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:22150589", "year": 2012, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1042/bj20111885" } ], "proteins": [ { "protein_id": "UP:O59676", "uniprot": "O59676", "gene": "pdp1", "organism": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)" } ], "structures": [ { "pdb_id": "2L89", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1074/jbc.m111.299149", "reference_id": "PMID:22247551", "reference_ids": [ "PMID:22247551" ], "title": "Structural insight into recognition of methylated histone tails by retinoblastoma-binding protein 1.", "authors": [ "Gong W", "Zhou T", "Mo J", "Perrett S", "Wang J", "Feng Y" ], "year": 2012, "year_values": [ 2012 ], "year_conflict": false, "journal": "The Journal of biological chemistry", "doi": "10.1074/jbc.m111.299149", "pmid": 22247551, "url": "https://doi.org/10.1074/jbc.m111.299149", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Royal-family domain comparison in ARID4A; chromobarrel coordinate 2LCC is not a PWWP structure", "verification_level": "primary_abstract_and_structural_metadata_verified", "source_records": [ { "reference_id": "PMID:22247551", "year": 2012, "source_type": "primary_experimental_research", "verification_level": "primary_abstract_and_structural_metadata_verified", "url": "https://doi.org/10.1074/jbc.m111.299149" } ], "proteins": [ { "protein_id": "UP:P29374", "uniprot": "P29374", "gene": "ARID4A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1371/journal.pone.0018919", "reference_id": "PMID:21720545", "reference_ids": [ "PMID:21720545" ], "title": "Structural and histone binding ability characterizations of human PWWP domains.", "authors": [ "Wu H", "Zeng H", "Lam R", "Tempel W", "Amaya MF", "Xu C", "Dombrovski L", "Qiu W", "Wang Y", "Min J" ], "year": 2011, "year_values": [ 2011 ], "year_conflict": false, "journal": "PloS one", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "url": "https://doi.org/10.1371/journal.pone.0018919", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Family-wide human PWWP structure and histone binding comparison", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:21720545", "year": 2011, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1371/journal.pone.0018919" } ], "proteins": [ { "protein_id": "UP:O95696", "uniprot": "O95696", "gene": "BRD1", "organism": "Homo sapiens" }, { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" }, { "protein_id": "UP:Q2TAK8", "uniprot": "Q2TAK8", "gene": "PWWP3A", "organism": "Homo sapiens" }, { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9ULD4", "uniprot": "Q9ULD4", "gene": "BRPF3", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3EAE", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3L42", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3LLR", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3LYI", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3MO8", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3PFS", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3PMI", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3QBY", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3QJ6", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3QKJ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" }, { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" }, { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [ { "name": "Bis-Tris", "preparation_id": "PREP:BIS-TRIS", "chemical_identity_status": "exact_single_CCD_identity", "assay_ids": [ "PWWP:ASSAY:0033", "PWWP:ASSAY:0034" ], "evidence_classes": [ "structural_occupancy_association" ], "domain_ids": [ "UP:Q9UBC3:PWWP1", "UP:Q9Y6K1:PWWP1" ] }, { "name": "H4K20me3 peptide / trimethyllysine monomer", "preparation_id": "PREP:H4K20me3_11mer", "chemical_identity_status": "defined_modified_peptide_sequence_not_monomer_identity", "assay_ids": [ "PWWP11:ASSAY:0010", "PWWP:ASSAY:0036" ], "evidence_classes": [ "qualitative_weak_binding", "structural_occupancy_association" ], "domain_ids": [ "UP:Q7Z4V5:PWWP1" ] } ], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/nsmb.1797", "reference_id": "PMID:20400950", "reference_ids": [ "PMID:20400950" ], "title": "Molecular basis of histone H3K36me3 recognition by the PWWP domain of Brpf1.", "authors": [ "Vezzoli A", "Bonadies N", "Allen MD", "Freund SM", "Santiveri CM", "Kvinlaug BT", "Huntly BJ", "Göttgens B", "Bycroft M" ], "year": 2010, "year_values": [ 2010 ], "year_conflict": false, "journal": "Nature structural & molecular biology", "doi": "10.1038/nsmb.1797", "pmid": 20400950, "url": "https://doi.org/10.1038/nsmb.1797", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "BRPF1 PWWP H3K36me3 molecular recognition", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:20400950", "year": 2010, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1038/nsmb.1797" } ], "proteins": [ { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2X35", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "2X4W", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "2X4X", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "2X4Y", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.molcel.2009.12.040", "reference_id": "PMID:20347427", "reference_ids": [ "PMID:20347427" ], "title": "Regulation of chromatin architecture by the PWWP domain-containing DNA damage-responsive factor EXPAND1/MUM1.", "authors": [ "Huen MS", "Huang J", "Leung JW", "Sy SM", "Leung KM", "Ching YP", "Tsao SW", "Chen J" ], "year": 2010, "year_values": [ 2010 ], "year_conflict": false, "journal": "Molecular cell", "doi": "10.1016/j.molcel.2009.12.040", "pmid": 20347427, "url": "https://doi.org/10.1016/j.molcel.2009.12.040", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "EXPAND1/MUM1 PWWP chromatin architecture and DNA damage response", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:20347427", "year": 2010, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.molcel.2009.12.040" } ], "proteins": [ { "protein_id": "UP:Q2TAK8", "uniprot": "Q2TAK8", "gene": "PWWP3A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1074/jbc.m109.089433", "reference_id": "PMID:20547484", "reference_ids": [ "PMID:20547484" ], "title": "The Dnmt3a PWWP domain reads histone 3 lysine 36 trimethylation and guides DNA methylation.", "authors": [ "Dhayalan A", "Rajavelu A", "Rathert P", "Tamas R", "Jurkowska RZ", "Ragozin S", "Jeltsch A" ], "year": 2010, "year_values": [ 2010 ], "year_conflict": false, "journal": "The Journal of biological chemistry", "doi": "10.1074/jbc.m109.089433", "pmid": 20547484, "url": "https://doi.org/10.1074/jbc.m109.089433", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "DNMT3A PWWP reading of H3K36me3", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:20547484", "year": 2010, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1074/jbc.m109.089433" } ], "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.molcel.2009.02.002", "reference_id": "PMID:19250904", "reference_ids": [ "PMID:19250904" ], "title": "Regulation of Set9-mediated H4K20 methylation by a PWWP domain protein.", "authors": [ "Wang Y", "Reddy B", "Thompson J", "Wang H", "Noma K", "Yates JR 3rd", "Jia S" ], "year": 2009, "year_values": [ 2009 ], "year_conflict": false, "journal": "Molecular cell", "doi": "10.1016/j.molcel.2009.02.002", "pmid": 19250904, "url": "https://doi.org/10.1016/j.molcel.2009.02.002", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Pdp1 PWWP control of Set9-dependent H4K20 methylation", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:19250904", "year": 2009, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.molcel.2009.02.002" } ], "proteins": [ { "protein_id": "UP:O59676", "uniprot": "O59676", "gene": "pdp1", "organism": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1021/bi7024639", "reference_id": "PMID:18484749", "reference_ids": [ "PMID:18484749" ], "title": "Human mismatch repair protein MSH6 contains a PWWP domain that targets double stranded DNA.", "authors": [ "Laguri C", "Duband-Goulet I", "Friedrich N", "Axt M", "Belin P", "Callebaut I", "Gilquin B", "Zinn-Justin S", "Couprie J" ], "year": 2008, "year_values": [ 2008 ], "year_conflict": false, "journal": "Biochemistry", "doi": "10.1021/bi7024639", "pmid": 18484749, "url": "https://doi.org/10.1021/bi7024639", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Experimental characterization of MSH6 PWWP as a dsDNA-binding module", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:18484749", "year": 2008, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1021/bi7024639" } ], "proteins": [ { "protein_id": "UP:P52701", "uniprot": "P52701", "gene": "MSH6", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1128/jvi.01561-08", "reference_id": "PMID:18799576", "reference_ids": [ "PMID:18799576" ], "title": "Identification and characterization of PWWP domain residues critical for LEDGF/p75 chromatin binding and human immunodeficiency virus type 1 infectivity.", "authors": [ "Shun MC", "Botbol Y", "Li X", "Di Nunzio F", "Daigle JE", "Yan N", "Lieberman J", "Lavigne M", "Engelman A" ], "year": 2008, "year_values": [ 2008 ], "year_conflict": false, "journal": "Journal of virology", "doi": "10.1128/jvi.01561-08", "pmid": 18799576, "url": "https://doi.org/10.1128/jvi.01561-08", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "LEDGF PWWP residues in chromatin binding and HIV infectivity", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:18799576", "year": 2008, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1128/jvi.01561-08" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1186/1471-2199-8-101", "reference_id": "PMID:17974029", "reference_ids": [ "PMID:17974029" ], "title": "Hepatoma-derived growth factor binds DNA through the N-terminal PWWP domain.", "authors": [ "Yang J", "Everett AD" ], "year": 2007, "year_values": [ 2007 ], "year_conflict": false, "journal": "BMC molecular biology", "doi": "10.1186/1471-2199-8-101", "pmid": 17974029, "url": "https://doi.org/10.1186/1471-2199-8-101", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "HDGF PWWP-mediated DNA binding", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "source_records": [ { "reference_id": "PMID:17974029", "year": 2007, "source_type": "primary_experimental_research", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "url": "https://doi.org/10.1186/1471-2199-8-101" } ], "proteins": [ { "protein_id": "UP:P51858", "uniprot": "P51858", "gene": "HDGF", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.jmb.2007.01.010", "reference_id": "PMID:17270212", "reference_ids": [ "PMID:17270212" ], "title": "PWWP module of human hepatoma-derived growth factor forms a domain-swapped dimer with much higher affinity for heparin.", "authors": [ "Sue SC", "Lee WT", "Tien SC", "Lee SC", "Yu JG", "Wu WJ", "Wu WG", "Huang TH" ], "year": 2007, "year_values": [ 2007 ], "year_conflict": false, "journal": "Journal of molecular biology", "doi": "10.1016/j.jmb.2007.01.010", "pmid": 17270212, "url": "https://doi.org/10.1016/j.jmb.2007.01.010", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Domain-swapped HDGF PWWP dimer and heparin binding", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:17270212", "year": 2007, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.jmb.2007.01.010" } ], "proteins": [ { "protein_id": "UP:P51858", "uniprot": "P51858", "gene": "HDGF", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2NLU", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1110/ps.051751706", "reference_id": "PMID:16384999", "reference_ids": [ "PMID:16384999" ], "title": "High resolution structure of the HDGF PWWP domain: a potential DNA binding domain.", "authors": [ "Lukasik SM", "Cierpicki T", "Borloz M", "Grembecka J", "Everett A", "Bushweller JH" ], "year": 2006, "year_values": [ 2006 ], "year_conflict": false, "journal": "Protein science : a publication of the Protein Society", "doi": "10.1110/ps.051751706", "pmid": 16384999, "url": "https://doi.org/10.1110/ps.051751706", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "High-resolution HDGF PWWP crystal structure", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:16384999", "year": 2006, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1110/ps.051751706" } ], "proteins": [ { "protein_id": "UP:P51858", "uniprot": "P51858", "gene": "HDGF", "organism": "Homo sapiens" }, { "protein_id": "UP:Q8VHK7", "uniprot": "Q8VHK7", "gene": "Hdgf", "organism": "Rattus norvegicus" } ], "structures": [ { "pdb_id": "2B8A", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1110/ps.04975305", "reference_id": "PMID:15689505", "reference_ids": [ "PMID:15689505" ], "title": "Solution structure of the PWWP domain of the hepatoma-derived growth factor family.", "authors": [ "Nameki N", "Tochio N", "Koshiba S", "Inoue M", "Yabuki T", "Aoki M", "Seki E", "Matsuda T", "Fujikura Y", "Saito M", "Ikari M", "Watanabe M", "Terada T", "Shirouzu M", "Yoshida M", "Hirota H", "Tanaka A", "Hayashizaki Y", "Güntert P", "Kigawa T", "Yokoyama S" ], "year": 2005, "year_values": [ 2005 ], "year_conflict": false, "journal": "Protein science : a publication of the Protein Society", "doi": "10.1110/ps.04975305", "pmid": 15689505, "url": "https://doi.org/10.1110/ps.04975305", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "HRP-3 PWWP solution structure", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:15689505", "year": 2005, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1110/ps.04975305" } ], "proteins": [ { "protein_id": "UP:Q9JMG7", "uniprot": "Q9JMG7", "gene": "Hdgfl3", "organism": "Mus musculus" }, { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "1N27", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1074/jbc.m312296200", "reference_id": "PMID:14998998", "reference_ids": [ "PMID:14998998" ], "title": "Chromatin targeting of de novo DNA methyltransferases by the PWWP domain.", "authors": [ "Ge YZ", "Pu MT", "Gowher H", "Wu HP", "Ding JP", "Jeltsch A", "Xu GL" ], "year": 2004, "year_values": [ 2004 ], "year_conflict": false, "journal": "The Journal of biological chemistry", "doi": "10.1074/jbc.m312296200", "pmid": 14998998, "url": "https://doi.org/10.1074/jbc.m312296200", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP-dependent chromatin targeting of de novo DNA methyltransferases", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:14998998", "year": 2004, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1074/jbc.m312296200" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/j.jmb.2004.09.014", "reference_id": "PMID:15491618", "reference_ids": [ "PMID:15491618" ], "title": "Solution structure and heparin interaction of human hepatoma-derived growth factor.", "authors": [ "Sue SC", "Chen JY", "Lee SC", "Wu WG", "Huang TH" ], "year": 2004, "year_values": [ 2004 ], "year_conflict": false, "journal": "Journal of molecular biology", "doi": "10.1016/j.jmb.2004.09.014", "pmid": 15491618, "url": "https://doi.org/10.1016/j.jmb.2004.09.014", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "HDGF solution structure and heparin interaction", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:15491618", "year": 2004, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.jmb.2004.09.014" } ], "proteins": [ { "protein_id": "UP:P51858", "uniprot": "P51858", "gene": "HDGF", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "1RI0", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1128/mcb.24.20.9048-9058.2004", "reference_id": "PMID:15456878", "reference_ids": [ "PMID:15456878" ], "title": "The PWWP domain of Dnmt3a and Dnmt3b is required for directing DNA methylation to the major satellite repeats at pericentric heterochromatin.", "authors": [ "Chen T", "Tsujimoto N", "Li E" ], "year": 2004, "year_values": [ 2004 ], "year_conflict": false, "journal": "Molecular and cellular biology", "doi": "10.1128/mcb.24.20.9048-9058.2004", "pmid": 15456878, "url": "https://doi.org/10.1128/mcb.24.20.9048-9058.2004", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP-directed pericentric heterochromatin methylation", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:15456878", "year": 2004, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1128/mcb.24.20.9048-9058.2004" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/s0022-2836(03)00470-4", "reference_id": "PMID:12842472", "reference_ids": [ "PMID:12842472" ], "title": "Structural variation in PWWP domains.", "authors": [ "Slater LM", "Allen MD", "Bycroft M" ], "year": 2003, "year_values": [ 2003 ], "year_conflict": false, "journal": "Journal of molecular biology", "doi": "10.1016/s0022-2836(03)00470-4", "pmid": 12842472, "url": "https://doi.org/10.1016/s0022-2836(03)00470-4", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Fission-yeast PWWP solution structure and structural variation", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:12842472", "year": 2003, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/s0022-2836(03)00470-4" } ], "proteins": [ { "protein_id": "UP:O59676", "uniprot": "O59676", "gene": "pdp1", "organism": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)" }, { "protein_id": "UP:O94312", "uniprot": "O94312", "gene": "pdp2", "organism": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)" } ], "structures": [ { "pdb_id": "1H3Z", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1038/nsb759", "reference_id": "PMID:11836534", "reference_ids": [ "PMID:11836534" ], "title": "The PWWP domain of mammalian DNA methyltransferase Dnmt3b defines a new family of DNA-binding folds.", "authors": [ "Qiu C", "Sawada K", "Zhang X", "Cheng X" ], "year": 2002, "year_values": [ 2002 ], "year_conflict": false, "journal": "Nature structural biology", "doi": "10.1038/nsb759", "pmid": 11836534, "url": "https://doi.org/10.1038/nsb759", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Foundational mammalian DNMT3B PWWP fold and DNA binding", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:11836534", "year": 2002, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1038/nsb759" } ], "proteins": [ { "protein_id": "UP:O88509", "uniprot": "O88509", "gene": "Dnmt3b", "organism": "Mus musculus" }, { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "1KHC", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "DOI:10.1016/s0014-5793(00)01449-6", "reference_id": "PMID:10802047", "reference_ids": [ "PMID:10802047" ], "title": "The PWWP domain: a potential protein-protein interaction domain in nuclear proteins influencing differentiation?", "authors": [ "Stec I", "Nagl SB", "van Ommen GJ", "den Dunnen JT" ], "year": 2000, "year_values": [ 2000 ], "year_conflict": false, "journal": "FEBS letters", "doi": "10.1016/s0014-5793(00)01449-6", "pmid": 10802047, "url": "https://doi.org/10.1016/s0014-5793(00)01449-6", "source_type": "family_analysis_indexed_as_review", "citation_role": "pwwp_research_context", "citation_role_label": "Family sequence analysis / review", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Original PWWP family definition and comparative sequence discovery", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:10802047", "year": 2000, "source_type": "family_analysis_indexed_as_review", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/s0014-5793(00)01449-6" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true }, { "id": "REF:PDB:9T2F:primary", "reference_id": "REF:PDB:9T2F:primary", "reference_ids": [ "REF:PDB:9T2F:primary" ], "title": "A fast, parallel method for efficiently exploring crystallization behaviour of large numbers of protein variants", "authors": [ "Fairhead, M.", "Strain-Damerell, C.", "Ye, M.", "Mackinnon, S.R.", "Pinkas, D.", "MacLean, E.M.", "Koekemoer, L.", "Damerell, D.", "Krojer, T.", "Arrowsmith, C.H.", "Edwards, A.", "Bountra, C.", "Yue, W.", "Burgess-Brown, N.", "Marsden, B.", "von Delft, F." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To Be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/9T2F", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:9T2F:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/9T2F" } ], "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9T2F", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:9T2G:primary", "reference_id": "REF:PDB:9T2G:primary", "reference_ids": [ "REF:PDB:9T2G:primary" ], "title": "A fast, parallel method for efficiently exploring crystallization behaviour of large numbers of protein variants", "authors": [ "Fairhead, M.", "Strain-Damerell, C.", "Ye, M.", "Mackinnon, S.R.", "Pinkas, D.", "MacLean, E.M.", "Koekemoer, L.", "Damerell, D.", "Krojer, T.", "Arrowsmith, C.H.", "Edwards, A.", "Bountra, C.", "Yue, W.", "Burgess-Brown, N.", "Marsden, B.", "von Delft, F." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To Be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/9T2G", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:9T2G:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/9T2G" } ], "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9T2G", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:3FLG:primary", "reference_id": "REF:PDB:3FLG:primary", "reference_ids": [ "REF:PDB:3FLG:primary" ], "title": "Crystal Structure of the PWWP domain of Human DNA (cytosine-5-)-methyltransferase 3 beta", "authors": [ "Zeng, H.", "Amaya, M.F.", "MacKenzie, F.", "Weigelt, J.", "Sundstrom, M.", "Arrowsmith, C.H.", "Edwards, A.M.", "Min, J.", "Wu, H." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/3FLG", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:3FLG:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/3FLG" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3FLG", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:4Z02:primary", "reference_id": "REF:PDB:4Z02:primary", "reference_ids": [ "REF:PDB:4Z02:primary" ], "title": "Crystal structure of BRD1 incomplex with Isoquinoline-3-carboxylic acid", "authors": [ "IQBAL, A.", "DONG, A.", "WALKER, J.R.", "Bountra, C.", "Arrowsmith, C.H.", "Edwards, A.M.", "BROWN, P.J.", "Structural Genomics Consortium (SGC)" ], "year": null, "year_values": [], "year_conflict": false, "journal": "to be published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/4Z02", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:4Z02:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/4Z02" } ], "proteins": [ { "protein_id": "UP:O95696", "uniprot": "O95696", "gene": "BRD1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4Z02", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:4LD6:primary", "reference_id": "REF:PDB:4LD6:primary", "reference_ids": [ "REF:PDB:4LD6:primary" ], "title": "Crystal structure of PWWP domain of human PWWP Domain-Containing Protein 2B", "authors": [ "Dombrovski, L.", "Dong, A.", "Tempel, W.", "Loppnau, P.", "Bountra, C.", "Arrowsmith, C.H.", "Edwards, A.M.", "Brown, P.J.", "Wu, H.", "Structural Genomics Consortium (SGC)" ], "year": null, "year_values": [], "year_conflict": false, "journal": "To be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/4LD6", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:4LD6:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/4LD6" } ], "proteins": [ { "protein_id": "UP:Q6NUJ5", "uniprot": "Q6NUJ5", "gene": "PWWP2B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4LD6", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:7V8N:primary", "reference_id": "REF:PDB:7V8N:primary", "reference_ids": [ "REF:PDB:7V8N:primary" ], "title": "Crystal structure of the PWWP-ARID of ARID4A", "authors": [ "Ren, D.", "Wei, X.", "Lin, L.", "Liu, L.", "Fan, Y.", "Lu, Q.", "He, G." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To Be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/7V8N", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:7V8N:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/7V8N" } ], "proteins": [ { "protein_id": "UP:P29374", "uniprot": "P29374", "gene": "ARID4A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7V8N", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:7LMT:primary", "reference_id": "REF:PDB:7LMT:primary", "reference_ids": [ "REF:PDB:7LMT:primary" ], "title": "Histone-lysine N-methyltransferase NSD2-PWWP1 with compound MRT10241866a", "authors": [ "Lei, M.", "Freitas, R.F.", "Dong, A.", "Schapira, M.", "Arrowsmith, C.H.", "Edwards, A.M.", "Min, J." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To Be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/7LMT", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:7LMT:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/7LMT" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7LMT", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:5C6S:primary", "reference_id": "REF:PDB:5C6S:primary", "reference_ids": [ "REF:PDB:5C6S:primary" ], "title": "Human Bromodomain and PHD Finger Containing 1, PWWP domain in complex with XST005904a", "authors": [ "DOBROVETSKY, E.", "DONG, A.", "MADER, P.", "Santhakumar, S.", "TEMPEL, W.", "Arrowsmith, C.H.", "Edwards, A.M.", "BROWN, P.J.", "Structural Genomics Consortium (SGC)" ], "year": null, "year_values": [], "year_conflict": false, "journal": "to be published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/5C6S", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:5C6S:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/5C6S" } ], "proteins": [ { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5C6S", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:6KCU:primary", "reference_id": "REF:PDB:6KCU:primary", "reference_ids": [ "REF:PDB:6KCU:primary" ], "title": "Shuguo PWWP domain", "authors": [ "Liu, Y.C.", "Huang, Y." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To Be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/6KCU", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:6KCU:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/6KCU" } ], "proteins": [ { "protein_id": "UP:Q9VAA9", "uniprot": "Q9VAA9", "gene": "Jasper", "organism": "Drosophila melanogaster" } ], "structures": [ { "pdb_id": "6KCU", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:6KD6:primary", "reference_id": "REF:PDB:6KD6:primary", "reference_ids": [ "REF:PDB:6KD6:primary" ], "title": "Shuguo PWWP domain", "authors": [ "Liu, Y.C.", "Huang, Y." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To Be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/6KD6", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:6KD6:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/6KD6" } ], "proteins": [ { "protein_id": "UP:Q9VAA9", "uniprot": "Q9VAA9", "gene": "Jasper", "organism": "Drosophila melanogaster" } ], "structures": [ { "pdb_id": "6KD6", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:6KCO:primary", "reference_id": "REF:PDB:6KCO:primary", "reference_ids": [ "REF:PDB:6KCO:primary" ], "title": "Shuguo PWWP in complex with ssDNA", "authors": [ "Liu, Y.C.", "Huang, Y." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To Be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/6KCO", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:6KCO:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/6KCO" } ], "proteins": [ { "protein_id": "UP:Q9VAA9", "uniprot": "Q9VAA9", "gene": "Jasper", "organism": "Drosophila melanogaster" } ], "structures": [ { "pdb_id": "6KCO", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:6KCP:primary", "reference_id": "REF:PDB:6KCP:primary", "reference_ids": [ "REF:PDB:6KCP:primary" ], "title": "Shuguo PWWP in complex with ssDNA", "authors": [ "Liu, Y.C.", "Huang, Y." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To Be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/6KCP", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:6KCP:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/6KCP" } ], "proteins": [ { "protein_id": "UP:Q9VAA9", "uniprot": "Q9VAA9", "gene": "Jasper", "organism": "Drosophila melanogaster" } ], "structures": [ { "pdb_id": "6KCP", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:2NAS:primary", "reference_id": "REF:PDB:2NAS:primary", "reference_ids": [ "REF:PDB:2NAS:primary" ], "title": "Soluion Structure of a PWWP domain from Trypanosoma brucei", "authors": [ "Wang, R.", "Liao, S.", "Dai, K.", "Zhang, J.", "Tu, X." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/2NAS", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:2NAS:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/2NAS" } ], "proteins": [ { "protein_id": "UP:Q586Y0", "uniprot": "Q586Y0", "gene": "28H13_90", "organism": "Trypanosoma brucei brucei (strain 927/4 GUTat10.1)" } ], "structures": [ { "pdb_id": "2NAS", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:2DAQ:primary", "reference_id": "REF:PDB:2DAQ:primary", "reference_ids": [ "REF:PDB:2DAQ:primary" ], "title": "Solution structure of second PWWP domain of WHSC1L1 protein", "authors": [ "Niraula, T.N.", "Tochio, N.", "Koshiba, S.", "Inoue, M.", "Kigawa, T.", "Yokoyama, S." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/2DAQ", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:2DAQ:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/2DAQ" } ], "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2DAQ", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:2YRV:primary", "reference_id": "REF:PDB:2YRV:primary", "reference_ids": [ "REF:PDB:2YRV:primary" ], "title": "Solution structure of the RBB1NT domain of human RB(retinoblastoma)-binding protein 1", "authors": [ "Nameki, N.", "Saito, K.", "Koshiba, S.", "Kigawa, T.", "Yokoyama, S." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/2YRV", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:2YRV:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/2YRV" } ], "proteins": [ { "protein_id": "UP:P29374", "uniprot": "P29374", "gene": "ARID4A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2YRV", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:5XSK:primary", "reference_id": "REF:PDB:5XSK:primary", "reference_ids": [ "REF:PDB:5XSK:primary" ], "title": "Structure of PWWP-DNA complex at 2.84 Angstroms resolution", "authors": [ "Chen, L.Y.", "Huang, Y.C.", "Hsieh, Y.C.", "Lin, P.J." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To Be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/5XSK", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:5XSK:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/5XSK" } ], "proteins": [ { "protein_id": "UP:Q8VHK7", "uniprot": "Q8VHK7", "gene": "Hdgf", "organism": "Rattus norvegicus" } ], "structures": [ { "pdb_id": "5XSK", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:5XSL:primary", "reference_id": "REF:PDB:5XSL:primary", "reference_ids": [ "REF:PDB:5XSL:primary" ], "title": "Structure of the PWWP domain at 3.3 Angstroms resolution", "authors": [ "Chen, L.Y.", "Huang, Y.C.", "Hsieh, Y.C.", "Lin, P.J." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To Be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/5XSL", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:5XSL:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/5XSL" } ], "proteins": [ { "protein_id": "UP:Q8VHK7", "uniprot": "Q8VHK7", "gene": "Hdgf", "organism": "Rattus norvegicus" } ], "structures": [ { "pdb_id": "5XSL", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:5NR3:primary", "reference_id": "REF:PDB:5NR3:primary", "reference_ids": [ "REF:PDB:5NR3:primary" ], "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "authors": [ "Rondelet, G.", "Dal Maso, T.", "Maniquet, A.", "Themans, Q.", "Wouters, J." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To be published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/5NR3", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:5NR3:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/5NR3" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NR3", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:5NRR:primary", "reference_id": "REF:PDB:5NRR:primary", "reference_ids": [ "REF:PDB:5NRR:primary" ], "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "authors": [ "Rondelet, G.", "Dal Maso, T.", "Maniquet, A.", "Themans, Q.", "Wouters, J." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To be published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/5NRR", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:5NRR:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/5NRR" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NRR", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:5NRS:primary", "reference_id": "REF:PDB:5NRS:primary", "reference_ids": [ "REF:PDB:5NRS:primary" ], "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "authors": [ "Rondelet, G.", "Dal Maso, T.", "Maniquet, A.", "Themans, Q.", "Wouters, J." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To be published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/5NRS", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:5NRS:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/5NRS" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NRS", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:5NRV:primary", "reference_id": "REF:PDB:5NRV:primary", "reference_ids": [ "REF:PDB:5NRV:primary" ], "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "authors": [ "Rondelet, G.", "Dal Maso, T.", "Maniquet, A.", "Themans, Q.", "Wouters, J." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To be published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/5NRV", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:5NRV:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/5NRV" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NRV", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:5NV0:primary", "reference_id": "REF:PDB:5NV0:primary", "reference_ids": [ "REF:PDB:5NV0:primary" ], "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "authors": [ "Rondelet, G.", "Dal Maso, T.", "Maniquet, A.", "Themans, Q.", "Wouters, J." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To Be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/5NV0", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:5NV0:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/5NV0" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NV0", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:5NV2:primary", "reference_id": "REF:PDB:5NV2:primary", "reference_ids": [ "REF:PDB:5NV2:primary" ], "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "authors": [ "Rondelet, G.", "Dal Maso, T.", "Maniquet, A.", "Themans, Q.", "Wouters, J." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To Be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/5NV2", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:5NV2:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/5NV2" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NV2", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:5NV7:primary", "reference_id": "REF:PDB:5NV7:primary", "reference_ids": [ "REF:PDB:5NV7:primary" ], "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "authors": [ "Rondelet, G.", "Dal Maso, T.", "Maniquet, A.", "Themans, Q.", "Wouters, J." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To be published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/5NV7", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:5NV7:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/5NV7" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NV7", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:5NVO:primary", "reference_id": "REF:PDB:5NVO:primary", "reference_ids": [ "REF:PDB:5NVO:primary" ], "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "authors": [ "Rondelet, G.", "Dal Maso, T.", "Maniquet, A.", "Themans, Q.", "Wouters, J." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To be published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/5NVO", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:5NVO:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/5NVO" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NVO", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:6R3E:primary", "reference_id": "REF:PDB:6R3E:primary", "reference_ids": [ "REF:PDB:6R3E:primary" ], "title": "Targeting PWWP domain of DNMT3B for epigenetic cancer therapy: identification and structural characterization of potential protein-protein interaction inhibitors", "authors": [ "Rondelet, G.", "Dal Maso, T.", "Maniquet, A.", "Themans, Q.", "Wouters, J." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To be published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/6R3E", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:6R3E:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/6R3E" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6R3E", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:2GFU:primary", "reference_id": "REF:PDB:2GFU:primary", "reference_ids": [ "REF:PDB:2GFU:primary" ], "title": "The PWWP domain of Mismatch Repair protein hMSH6 is involved in double stranded and single stranded DNA binding", "authors": [ "Laguri, C.", "Duband-Goulet, I.", "Friedrich, N.", "Axt, M.", "Belin, P.", "Gilquin, B.", "Zinn-Justin, S.", "Couprie, J." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/2GFU", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:2GFU:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/2GFU" } ], "proteins": [ { "protein_id": "UP:P52701", "uniprot": "P52701", "gene": "MSH6", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2GFU", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:9E3U:primary", "reference_id": "REF:PDB:9E3U:primary", "reference_ids": [ "REF:PDB:9E3U:primary" ], "title": "The structural basis for de novo DNA methylation in chromatin", "authors": [ "Xie, X.", "Liu, M.", "Zhou, X.E.", "Worden, E.", "Jones, P." ], "year": null, "year_values": [], "year_conflict": false, "journal": "To Be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/9E3U", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:9E3U:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/9E3U" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E3U", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false }, { "id": "REF:PDB:6OQM:primary", "reference_id": "REF:PDB:6OQM:primary", "reference_ids": [ "REF:PDB:6OQM:primary" ], "title": "crystal structure of the MSH6 PWWP domain", "authors": [ "Qin, S.", "Tempel, W.", "Bountra, C.", "Arrowsmith, C.H.", "Edwards, A.M.", "Min, J.", "Structural Genomics Consortium (SGC)" ], "year": null, "year_values": [], "year_conflict": false, "journal": "To Be Published", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/6OQM", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:6OQM:primary", "year": null, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/6OQM" } ], "proteins": [ { "protein_id": "UP:P52701", "uniprot": "P52701", "gene": "MSH6", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6OQM", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "unknown", "date_note": "No publication year in this source record. A deposition date is not substituted.", "is_publication": false } ], "events": [ { "id": "DOI:10.1016/s0014-5793(00)01449-6", "reference_id": "PMID:10802047", "reference_ids": [ "PMID:10802047" ], "title": "The PWWP domain: a potential protein-protein interaction domain in nuclear proteins influencing differentiation?", "authors": [ "Stec I", "Nagl SB", "van Ommen GJ", "den Dunnen JT" ], "year": 2000, "year_values": [ 2000 ], "year_conflict": false, "journal": "FEBS letters", "doi": "10.1016/s0014-5793(00)01449-6", "pmid": 10802047, "url": "https://doi.org/10.1016/s0014-5793(00)01449-6", "source_type": "family_analysis_indexed_as_review", "citation_role": "pwwp_research_context", "citation_role_label": "Family sequence analysis / review", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Original PWWP family definition and comparative sequence discovery", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:10802047", "year": 2000, "source_type": "family_analysis_indexed_as_review", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/s0014-5793(00)01449-6" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/s0014-5793(00)01449-6", "kind": "publication", "kind_label": "Publication year", "date": "2000", "sort_date": "2000-00-00" }, { "event_id": "PDB:1KHC:deposition", "id": "1KHC", "kind": "deposition", "kind_label": "PDB deposition", "date": "2001-11-29", "sort_date": "2001-11-29", "year": 2001, "title": "Crystal Structure of the PWWP Domain of Mammalian DNA Methyltransferase Dnmt3b", "url": "https://www.rcsb.org/structure/1KHC", "proteins": [ { "protein_id": "UP:O88509", "uniprot": "O88509", "gene": "Dnmt3b", "organism": "Mus musculus" } ], "structures": [ { "pdb_id": "1KHC", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O88509:PWWP1", "gene": "Dnmt3b", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/nsb759", "title": "The PWWP domain of mammalian DNA methyltransferase Dnmt3b defines a new family of DNA-binding folds.", "url": "https://doi.org/10.1038/nsb759", "doi": "10.1038/nsb759", "pmid": 11836534, "year": 2002 } ], "date_precision": "day", "source_date": "2001-11-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1038/nsb759", "reference_id": "PMID:11836534", "reference_ids": [ "PMID:11836534" ], "title": "The PWWP domain of mammalian DNA methyltransferase Dnmt3b defines a new family of DNA-binding folds.", "authors": [ "Qiu C", "Sawada K", "Zhang X", "Cheng X" ], "year": 2002, "year_values": [ 2002 ], "year_conflict": false, "journal": "Nature structural biology", "doi": "10.1038/nsb759", "pmid": 11836534, "url": "https://doi.org/10.1038/nsb759", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Foundational mammalian DNMT3B PWWP fold and DNA binding", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:11836534", "year": 2002, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1038/nsb759" } ], "proteins": [ { "protein_id": "UP:O88509", "uniprot": "O88509", "gene": "Dnmt3b", "organism": "Mus musculus" }, { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "1KHC", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/nsb759", "kind": "publication", "kind_label": "Publication year", "date": "2002", "sort_date": "2002-00-00" }, { "event_id": "PDB:1KHC:release", "id": "1KHC", "kind": "release", "kind_label": "PDB initial release", "date": "2002-02-27", "sort_date": "2002-02-27", "year": 2002, "title": "Crystal Structure of the PWWP Domain of Mammalian DNA Methyltransferase Dnmt3b", "url": "https://www.rcsb.org/structure/1KHC", "proteins": [ { "protein_id": "UP:O88509", "uniprot": "O88509", "gene": "Dnmt3b", "organism": "Mus musculus" } ], "structures": [ { "pdb_id": "1KHC", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O88509:PWWP1", "gene": "Dnmt3b", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/nsb759", "title": "The PWWP domain of mammalian DNA methyltransferase Dnmt3b defines a new family of DNA-binding folds.", "url": "https://doi.org/10.1038/nsb759", "doi": "10.1038/nsb759", "pmid": 11836534, "year": 2002 } ], "date_precision": "day", "source_date": "2002-02-27T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:1H3Z:deposition", "id": "1H3Z", "kind": "deposition", "kind_label": "PDB deposition", "date": "2002-09-23", "sort_date": "2002-09-23", "year": 2002, "title": "Solution structure of a PWWP domain from Schizosaccharomyces Pombe", "url": "https://www.rcsb.org/structure/1H3Z", "proteins": [ { "protein_id": "UP:O94312", "uniprot": "O94312", "gene": "pdp2", "organism": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)" } ], "structures": [ { "pdb_id": "1H3Z", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O94312:PWWP1", "gene": "pdp2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/s0022-2836(03)00470-4", "title": "Structural variation in PWWP domains.", "url": "https://doi.org/10.1016/s0022-2836(03)00470-4", "doi": "10.1016/s0022-2836(03)00470-4", "pmid": 12842472, "year": 2003 } ], "date_precision": "day", "source_date": "2002-09-23T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:1N27:deposition", "id": "1N27", "kind": "deposition", "kind_label": "PDB deposition", "date": "2002-10-22", "sort_date": "2002-10-22", "year": 2002, "title": "Solution structure of the PWWP domain of mouse Hepatoma-derived growth factor, related protein 3", "url": "https://www.rcsb.org/structure/1N27", "proteins": [ { "protein_id": "UP:Q9JMG7", "uniprot": "Q9JMG7", "gene": "Hdgfl3", "organism": "Mus musculus" } ], "structures": [ { "pdb_id": "1N27", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9JMG7:PWWP1", "gene": "Hdgfl3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1110/ps.04975305", "title": "Solution structure of the PWWP domain of the hepatoma-derived growth factor family.", "url": "https://doi.org/10.1110/ps.04975305", "doi": "10.1110/ps.04975305", "pmid": 15689505, "year": 2005 } ], "date_precision": "day", "source_date": "2002-10-22T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1016/s0022-2836(03)00470-4", "reference_id": "PMID:12842472", "reference_ids": [ "PMID:12842472" ], "title": "Structural variation in PWWP domains.", "authors": [ "Slater LM", "Allen MD", "Bycroft M" ], "year": 2003, "year_values": [ 2003 ], "year_conflict": false, "journal": "Journal of molecular biology", "doi": "10.1016/s0022-2836(03)00470-4", "pmid": 12842472, "url": "https://doi.org/10.1016/s0022-2836(03)00470-4", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Fission-yeast PWWP solution structure and structural variation", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:12842472", "year": 2003, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/s0022-2836(03)00470-4" } ], "proteins": [ { "protein_id": "UP:O59676", "uniprot": "O59676", "gene": "pdp1", "organism": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)" }, { "protein_id": "UP:O94312", "uniprot": "O94312", "gene": "pdp2", "organism": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)" } ], "structures": [ { "pdb_id": "1H3Z", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/s0022-2836(03)00470-4", "kind": "publication", "kind_label": "Publication year", "date": "2003", "sort_date": "2003-00-00" }, { "event_id": "PDB:1H3Z:release", "id": "1H3Z", "kind": "release", "kind_label": "PDB initial release", "date": "2003-07-10", "sort_date": "2003-07-10", "year": 2003, "title": "Solution structure of a PWWP domain from Schizosaccharomyces Pombe", "url": "https://www.rcsb.org/structure/1H3Z", "proteins": [ { "protein_id": "UP:O94312", "uniprot": "O94312", "gene": "pdp2", "organism": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)" } ], "structures": [ { "pdb_id": "1H3Z", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O94312:PWWP1", "gene": "pdp2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/s0022-2836(03)00470-4", "title": "Structural variation in PWWP domains.", "url": "https://doi.org/10.1016/s0022-2836(03)00470-4", "doi": "10.1016/s0022-2836(03)00470-4", "pmid": 12842472, "year": 2003 } ], "date_precision": "day", "source_date": "2003-07-10T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:1RI0:deposition", "id": "1RI0", "kind": "deposition", "kind_label": "PDB deposition", "date": "2003-11-16", "sort_date": "2003-11-16", "year": 2003, "title": "NMR structure of the N-terminal hath domain of human HDGF", "url": "https://www.rcsb.org/structure/1RI0", "proteins": [ { "protein_id": "UP:P51858", "uniprot": "P51858", "gene": "HDGF", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "1RI0", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P51858:PWWP1", "gene": "HDGF", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.jmb.2004.09.014", "title": "Solution structure and heparin interaction of human hepatoma-derived growth factor.", "url": "https://doi.org/10.1016/j.jmb.2004.09.014", "doi": "10.1016/j.jmb.2004.09.014", "pmid": 15491618, "year": 2004 } ], "date_precision": "day", "source_date": "2003-11-16T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:1N27:release", "id": "1N27", "kind": "release", "kind_label": "PDB initial release", "date": "2003-12-23", "sort_date": "2003-12-23", "year": 2003, "title": "Solution structure of the PWWP domain of mouse Hepatoma-derived growth factor, related protein 3", "url": "https://www.rcsb.org/structure/1N27", "proteins": [ { "protein_id": "UP:Q9JMG7", "uniprot": "Q9JMG7", "gene": "Hdgfl3", "organism": "Mus musculus" } ], "structures": [ { "pdb_id": "1N27", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9JMG7:PWWP1", "gene": "Hdgfl3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1110/ps.04975305", "title": "Solution structure of the PWWP domain of the hepatoma-derived growth factor family.", "url": "https://doi.org/10.1110/ps.04975305", "doi": "10.1110/ps.04975305", "pmid": 15689505, "year": 2005 } ], "date_precision": "day", "source_date": "2003-12-23T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1016/j.jmb.2004.09.014", "reference_id": "PMID:15491618", "reference_ids": [ "PMID:15491618" ], "title": "Solution structure and heparin interaction of human hepatoma-derived growth factor.", "authors": [ "Sue SC", "Chen JY", "Lee SC", "Wu WG", "Huang TH" ], "year": 2004, "year_values": [ 2004 ], "year_conflict": false, "journal": "Journal of molecular biology", "doi": "10.1016/j.jmb.2004.09.014", "pmid": 15491618, "url": "https://doi.org/10.1016/j.jmb.2004.09.014", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "HDGF solution structure and heparin interaction", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:15491618", "year": 2004, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.jmb.2004.09.014" } ], "proteins": [ { "protein_id": "UP:P51858", "uniprot": "P51858", "gene": "HDGF", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "1RI0", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.jmb.2004.09.014", "kind": "publication", "kind_label": "Publication year", "date": "2004", "sort_date": "2004-00-00" }, { "id": "DOI:10.1074/jbc.m312296200", "reference_id": "PMID:14998998", "reference_ids": [ "PMID:14998998" ], "title": "Chromatin targeting of de novo DNA methyltransferases by the PWWP domain.", "authors": [ "Ge YZ", "Pu MT", "Gowher H", "Wu HP", "Ding JP", "Jeltsch A", "Xu GL" ], "year": 2004, "year_values": [ 2004 ], "year_conflict": false, "journal": "The Journal of biological chemistry", "doi": "10.1074/jbc.m312296200", "pmid": 14998998, "url": "https://doi.org/10.1074/jbc.m312296200", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP-dependent chromatin targeting of de novo DNA methyltransferases", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:14998998", "year": 2004, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1074/jbc.m312296200" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1074/jbc.m312296200", "kind": "publication", "kind_label": "Publication year", "date": "2004", "sort_date": "2004-00-00" }, { "id": "DOI:10.1128/mcb.24.20.9048-9058.2004", "reference_id": "PMID:15456878", "reference_ids": [ "PMID:15456878" ], "title": "The PWWP domain of Dnmt3a and Dnmt3b is required for directing DNA methylation to the major satellite repeats at pericentric heterochromatin.", "authors": [ "Chen T", "Tsujimoto N", "Li E" ], "year": 2004, "year_values": [ 2004 ], "year_conflict": false, "journal": "Molecular and cellular biology", "doi": "10.1128/mcb.24.20.9048-9058.2004", "pmid": 15456878, "url": "https://doi.org/10.1128/mcb.24.20.9048-9058.2004", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP-directed pericentric heterochromatin methylation", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:15456878", "year": 2004, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1128/mcb.24.20.9048-9058.2004" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1128/mcb.24.20.9048-9058.2004", "kind": "publication", "kind_label": "Publication year", "date": "2004", "sort_date": "2004-00-00" }, { "event_id": "PDB:1RI0:release", "id": "1RI0", "kind": "release", "kind_label": "PDB initial release", "date": "2004-11-16", "sort_date": "2004-11-16", "year": 2004, "title": "NMR structure of the N-terminal hath domain of human HDGF", "url": "https://www.rcsb.org/structure/1RI0", "proteins": [ { "protein_id": "UP:P51858", "uniprot": "P51858", "gene": "HDGF", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "1RI0", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P51858:PWWP1", "gene": "HDGF", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.jmb.2004.09.014", "title": "Solution structure and heparin interaction of human hepatoma-derived growth factor.", "url": "https://doi.org/10.1016/j.jmb.2004.09.014", "doi": "10.1016/j.jmb.2004.09.014", "pmid": 15491618, "year": 2004 } ], "date_precision": "day", "source_date": "2004-11-16T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1110/ps.04975305", "reference_id": "PMID:15689505", "reference_ids": [ "PMID:15689505" ], "title": "Solution structure of the PWWP domain of the hepatoma-derived growth factor family.", "authors": [ "Nameki N", "Tochio N", "Koshiba S", "Inoue M", "Yabuki T", "Aoki M", "Seki E", "Matsuda T", "Fujikura Y", "Saito M", "Ikari M", "Watanabe M", "Terada T", "Shirouzu M", "Yoshida M", "Hirota H", "Tanaka A", "Hayashizaki Y", "Güntert P", "Kigawa T", "Yokoyama S" ], "year": 2005, "year_values": [ 2005 ], "year_conflict": false, "journal": "Protein science : a publication of the Protein Society", "doi": "10.1110/ps.04975305", "pmid": 15689505, "url": "https://doi.org/10.1110/ps.04975305", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "HRP-3 PWWP solution structure", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:15689505", "year": 2005, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1110/ps.04975305" } ], "proteins": [ { "protein_id": "UP:Q9JMG7", "uniprot": "Q9JMG7", "gene": "Hdgfl3", "organism": "Mus musculus" }, { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "1N27", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1110/ps.04975305", "kind": "publication", "kind_label": "Publication year", "date": "2005", "sort_date": "2005-00-00" }, { "event_id": "PDB:2B8A:deposition", "id": "2B8A", "kind": "deposition", "kind_label": "PDB deposition", "date": "2005-10-06", "sort_date": "2005-10-06", "year": 2005, "title": "High Resolution Structure of the HDGF PWWP Domain", "url": "https://www.rcsb.org/structure/2B8A", "proteins": [ { "protein_id": "UP:Q8VHK7", "uniprot": "Q8VHK7", "gene": "Hdgf", "organism": "Rattus norvegicus" } ], "structures": [ { "pdb_id": "2B8A", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q8VHK7:PWWP1", "gene": "Hdgf", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1110/ps.051751706", "title": "High resolution structure of the HDGF PWWP domain: a potential DNA binding domain.", "url": "https://doi.org/10.1110/ps.051751706", "doi": "10.1110/ps.051751706", "pmid": 16384999, "year": 2006 } ], "date_precision": "day", "source_date": "2005-10-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:2B8A:release", "id": "2B8A", "kind": "release", "kind_label": "PDB initial release", "date": "2005-12-06", "sort_date": "2005-12-06", "year": 2005, "title": "High Resolution Structure of the HDGF PWWP Domain", "url": "https://www.rcsb.org/structure/2B8A", "proteins": [ { "protein_id": "UP:Q8VHK7", "uniprot": "Q8VHK7", "gene": "Hdgf", "organism": "Rattus norvegicus" } ], "structures": [ { "pdb_id": "2B8A", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q8VHK7:PWWP1", "gene": "Hdgf", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1110/ps.051751706", "title": "High resolution structure of the HDGF PWWP domain: a potential DNA binding domain.", "url": "https://doi.org/10.1110/ps.051751706", "doi": "10.1110/ps.051751706", "pmid": 16384999, "year": 2006 } ], "date_precision": "day", "source_date": "2005-12-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:2DAQ:deposition", "id": "2DAQ", "kind": "deposition", "kind_label": "PDB deposition", "date": "2005-12-14", "sort_date": "2005-12-14", "year": 2005, "title": "Solution structure of second PWWP domain of WHSC1L1 protein", "url": "https://www.rcsb.org/structure/2DAQ", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2DAQ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP2", "gene": "NSD3", "domain_name": "PWWP2" } ], "ligands": [], "references": [ { "id": "REF:PDB:2DAQ:primary", "title": "Solution structure of second PWWP domain of WHSC1L1 protein", "url": "https://www.rcsb.org/structure/2DAQ", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2005-12-14T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1110/ps.051751706", "reference_id": "PMID:16384999", "reference_ids": [ "PMID:16384999" ], "title": "High resolution structure of the HDGF PWWP domain: a potential DNA binding domain.", "authors": [ "Lukasik SM", "Cierpicki T", "Borloz M", "Grembecka J", "Everett A", "Bushweller JH" ], "year": 2006, "year_values": [ 2006 ], "year_conflict": false, "journal": "Protein science : a publication of the Protein Society", "doi": "10.1110/ps.051751706", "pmid": 16384999, "url": "https://doi.org/10.1110/ps.051751706", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "High-resolution HDGF PWWP crystal structure", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:16384999", "year": 2006, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1110/ps.051751706" } ], "proteins": [ { "protein_id": "UP:P51858", "uniprot": "P51858", "gene": "HDGF", "organism": "Homo sapiens" }, { "protein_id": "UP:Q8VHK7", "uniprot": "Q8VHK7", "gene": "Hdgf", "organism": "Rattus norvegicus" } ], "structures": [ { "pdb_id": "2B8A", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1110/ps.051751706", "kind": "publication", "kind_label": "Publication year", "date": "2006", "sort_date": "2006-00-00" }, { "event_id": "PDB:2GFU:deposition", "id": "2GFU", "kind": "deposition", "kind_label": "PDB deposition", "date": "2006-03-23", "sort_date": "2006-03-23", "year": 2006, "title": "NMR solution structure of the PWWP domain of Mismatch repair protein hMSH6", "url": "https://www.rcsb.org/structure/2GFU", "proteins": [ { "protein_id": "UP:P52701", "uniprot": "P52701", "gene": "MSH6", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2GFU", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P52701:PWWP1", "gene": "MSH6", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:2GFU:primary", "title": "The PWWP domain of Mismatch Repair protein hMSH6 is involved in double stranded and single stranded DNA binding", "url": "https://www.rcsb.org/structure/2GFU", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2006-03-23T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:2DAQ:release", "id": "2DAQ", "kind": "release", "kind_label": "PDB initial release", "date": "2006-06-14", "sort_date": "2006-06-14", "year": 2006, "title": "Solution structure of second PWWP domain of WHSC1L1 protein", "url": "https://www.rcsb.org/structure/2DAQ", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2DAQ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP2", "gene": "NSD3", "domain_name": "PWWP2" } ], "ligands": [], "references": [ { "id": "REF:PDB:2DAQ:primary", "title": "Solution structure of second PWWP domain of WHSC1L1 protein", "url": "https://www.rcsb.org/structure/2DAQ", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2006-06-14T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:2NLU:deposition", "id": "2NLU", "kind": "deposition", "kind_label": "PDB deposition", "date": "2006-10-20", "sort_date": "2006-10-20", "year": 2006, "title": "Domain-Swapped Dimer of the PWWP Module of Human Hepatoma-derived Growth Factor", "url": "https://www.rcsb.org/structure/2NLU", "proteins": [ { "protein_id": "UP:P51858", "uniprot": "P51858", "gene": "HDGF", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2NLU", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P51858:PWWP1", "gene": "HDGF", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.jmb.2007.01.010", "title": "PWWP module of human hepatoma-derived growth factor forms a domain-swapped dimer with much higher affinity for heparin.", "url": "https://doi.org/10.1016/j.jmb.2007.01.010", "doi": "10.1016/j.jmb.2007.01.010", "pmid": 17270212, "year": 2007 } ], "date_precision": "day", "source_date": "2006-10-20T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1016/j.jmb.2007.01.010", "reference_id": "PMID:17270212", "reference_ids": [ "PMID:17270212" ], "title": "PWWP module of human hepatoma-derived growth factor forms a domain-swapped dimer with much higher affinity for heparin.", "authors": [ "Sue SC", "Lee WT", "Tien SC", "Lee SC", "Yu JG", "Wu WJ", "Wu WG", "Huang TH" ], "year": 2007, "year_values": [ 2007 ], "year_conflict": false, "journal": "Journal of molecular biology", "doi": "10.1016/j.jmb.2007.01.010", "pmid": 17270212, "url": "https://doi.org/10.1016/j.jmb.2007.01.010", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Domain-swapped HDGF PWWP dimer and heparin binding", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:17270212", "year": 2007, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.jmb.2007.01.010" } ], "proteins": [ { "protein_id": "UP:P51858", "uniprot": "P51858", "gene": "HDGF", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2NLU", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.jmb.2007.01.010", "kind": "publication", "kind_label": "Publication year", "date": "2007", "sort_date": "2007-00-00" }, { "id": "DOI:10.1186/1471-2199-8-101", "reference_id": "PMID:17974029", "reference_ids": [ "PMID:17974029" ], "title": "Hepatoma-derived growth factor binds DNA through the N-terminal PWWP domain.", "authors": [ "Yang J", "Everett AD" ], "year": 2007, "year_values": [ 2007 ], "year_conflict": false, "journal": "BMC molecular biology", "doi": "10.1186/1471-2199-8-101", "pmid": 17974029, "url": "https://doi.org/10.1186/1471-2199-8-101", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "HDGF PWWP-mediated DNA binding", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "source_records": [ { "reference_id": "PMID:17974029", "year": 2007, "source_type": "primary_experimental_research", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "url": "https://doi.org/10.1186/1471-2199-8-101" } ], "proteins": [ { "protein_id": "UP:P51858", "uniprot": "P51858", "gene": "HDGF", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1186/1471-2199-8-101", "kind": "publication", "kind_label": "Publication year", "date": "2007", "sort_date": "2007-00-00" }, { "event_id": "PDB:2YRV:deposition", "id": "2YRV", "kind": "deposition", "kind_label": "PDB deposition", "date": "2007-04-03", "sort_date": "2007-04-03", "year": 2007, "title": "Solution structure of the RBB1NT domain of human RB(retinoblastoma)-binding protein 1", "url": "https://www.rcsb.org/structure/2YRV", "proteins": [ { "protein_id": "UP:P29374", "uniprot": "P29374", "gene": "ARID4A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2YRV", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P29374:PWWP1", "gene": "ARID4A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:2YRV:primary", "title": "Solution structure of the RBB1NT domain of human RB(retinoblastoma)-binding protein 1", "url": "https://www.rcsb.org/structure/2YRV", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2007-04-03T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:2GFU:release", "id": "2GFU", "kind": "release", "kind_label": "PDB initial release", "date": "2007-04-10", "sort_date": "2007-04-10", "year": 2007, "title": "NMR solution structure of the PWWP domain of Mismatch repair protein hMSH6", "url": "https://www.rcsb.org/structure/2GFU", "proteins": [ { "protein_id": "UP:P52701", "uniprot": "P52701", "gene": "MSH6", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2GFU", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P52701:PWWP1", "gene": "MSH6", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:2GFU:primary", "title": "The PWWP domain of Mismatch Repair protein hMSH6 is involved in double stranded and single stranded DNA binding", "url": "https://www.rcsb.org/structure/2GFU", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2007-04-10T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:2NLU:release", "id": "2NLU", "kind": "release", "kind_label": "PDB initial release", "date": "2007-09-04", "sort_date": "2007-09-04", "year": 2007, "title": "Domain-Swapped Dimer of the PWWP Module of Human Hepatoma-derived Growth Factor", "url": "https://www.rcsb.org/structure/2NLU", "proteins": [ { "protein_id": "UP:P51858", "uniprot": "P51858", "gene": "HDGF", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2NLU", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P51858:PWWP1", "gene": "HDGF", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.jmb.2007.01.010", "title": "PWWP module of human hepatoma-derived growth factor forms a domain-swapped dimer with much higher affinity for heparin.", "url": "https://doi.org/10.1016/j.jmb.2007.01.010", "doi": "10.1016/j.jmb.2007.01.010", "pmid": 17270212, "year": 2007 } ], "date_precision": "day", "source_date": "2007-09-04T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1021/bi7024639", "reference_id": "PMID:18484749", "reference_ids": [ "PMID:18484749" ], "title": "Human mismatch repair protein MSH6 contains a PWWP domain that targets double stranded DNA.", "authors": [ "Laguri C", "Duband-Goulet I", "Friedrich N", "Axt M", "Belin P", "Callebaut I", "Gilquin B", "Zinn-Justin S", "Couprie J" ], "year": 2008, "year_values": [ 2008 ], "year_conflict": false, "journal": "Biochemistry", "doi": "10.1021/bi7024639", "pmid": 18484749, "url": "https://doi.org/10.1021/bi7024639", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Experimental characterization of MSH6 PWWP as a dsDNA-binding module", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:18484749", "year": 2008, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1021/bi7024639" } ], "proteins": [ { "protein_id": "UP:P52701", "uniprot": "P52701", "gene": "MSH6", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1021/bi7024639", "kind": "publication", "kind_label": "Publication year", "date": "2008", "sort_date": "2008-00-00" }, { "id": "DOI:10.1128/jvi.01561-08", "reference_id": "PMID:18799576", "reference_ids": [ "PMID:18799576" ], "title": "Identification and characterization of PWWP domain residues critical for LEDGF/p75 chromatin binding and human immunodeficiency virus type 1 infectivity.", "authors": [ "Shun MC", "Botbol Y", "Li X", "Di Nunzio F", "Daigle JE", "Yan N", "Lieberman J", "Lavigne M", "Engelman A" ], "year": 2008, "year_values": [ 2008 ], "year_conflict": false, "journal": "Journal of virology", "doi": "10.1128/jvi.01561-08", "pmid": 18799576, "url": "https://doi.org/10.1128/jvi.01561-08", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "LEDGF PWWP residues in chromatin binding and HIV infectivity", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:18799576", "year": 2008, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1128/jvi.01561-08" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1128/jvi.01561-08", "kind": "publication", "kind_label": "Publication year", "date": "2008", "sort_date": "2008-00-00" }, { "event_id": "PDB:2YRV:release", "id": "2YRV", "kind": "release", "kind_label": "PDB initial release", "date": "2008-04-08", "sort_date": "2008-04-08", "year": 2008, "title": "Solution structure of the RBB1NT domain of human RB(retinoblastoma)-binding protein 1", "url": "https://www.rcsb.org/structure/2YRV", "proteins": [ { "protein_id": "UP:P29374", "uniprot": "P29374", "gene": "ARID4A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2YRV", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P29374:PWWP1", "gene": "ARID4A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:2YRV:primary", "title": "Solution structure of the RBB1NT domain of human RB(retinoblastoma)-binding protein 1", "url": "https://www.rcsb.org/structure/2YRV", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2008-04-08T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3EAE:deposition", "id": "3EAE", "kind": "deposition", "kind_label": "PDB deposition", "date": "2008-08-25", "sort_date": "2008-08-25", "year": 2008, "title": "PWWP domain of human hepatoma-derived growth factor 2 (HDGF2)", "url": "https://www.rcsb.org/structure/3EAE", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3EAE", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2008-08-25T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3EAE:release", "id": "3EAE", "kind": "release", "kind_label": "PDB initial release", "date": "2008-09-16", "sort_date": "2008-09-16", "year": 2008, "title": "PWWP domain of human hepatoma-derived growth factor 2 (HDGF2)", "url": "https://www.rcsb.org/structure/3EAE", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3EAE", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2008-09-16T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3FLG:deposition", "id": "3FLG", "kind": "deposition", "kind_label": "PDB deposition", "date": "2008-12-18", "sort_date": "2008-12-18", "year": 2008, "title": "The PWWP domain of Human DNA (cytosine-5-)-methyltransferase 3 beta", "url": "https://www.rcsb.org/structure/3FLG", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3FLG", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:3FLG:primary", "title": "Crystal Structure of the PWWP domain of Human DNA (cytosine-5-)-methyltransferase 3 beta", "url": "https://www.rcsb.org/structure/3FLG", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2008-12-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1016/j.molcel.2009.02.002", "reference_id": "PMID:19250904", "reference_ids": [ "PMID:19250904" ], "title": "Regulation of Set9-mediated H4K20 methylation by a PWWP domain protein.", "authors": [ "Wang Y", "Reddy B", "Thompson J", "Wang H", "Noma K", "Yates JR 3rd", "Jia S" ], "year": 2009, "year_values": [ 2009 ], "year_conflict": false, "journal": "Molecular cell", "doi": "10.1016/j.molcel.2009.02.002", "pmid": 19250904, "url": "https://doi.org/10.1016/j.molcel.2009.02.002", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Pdp1 PWWP control of Set9-dependent H4K20 methylation", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:19250904", "year": 2009, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.molcel.2009.02.002" } ], "proteins": [ { "protein_id": "UP:O59676", "uniprot": "O59676", "gene": "pdp1", "organism": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.molcel.2009.02.002", "kind": "publication", "kind_label": "Publication year", "date": "2009", "sort_date": "2009-00-00" }, { "event_id": "PDB:3FLG:release", "id": "3FLG", "kind": "release", "kind_label": "PDB initial release", "date": "2009-03-31", "sort_date": "2009-03-31", "year": 2009, "title": "The PWWP domain of Human DNA (cytosine-5-)-methyltransferase 3 beta", "url": "https://www.rcsb.org/structure/3FLG", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3FLG", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:3FLG:primary", "title": "Crystal Structure of the PWWP domain of Human DNA (cytosine-5-)-methyltransferase 3 beta", "url": "https://www.rcsb.org/structure/3FLG", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2009-03-31T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3L42:deposition", "id": "3L42", "kind": "deposition", "kind_label": "PDB deposition", "date": "2009-12-18", "sort_date": "2009-12-18", "year": 2009, "title": "PWWP domain of human bromodomain and PHD finger containing protein 1", "url": "https://www.rcsb.org/structure/3L42", "proteins": [ { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3L42", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P55201:PWWP1", "gene": "BRPF1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2009-12-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1016/j.molcel.2009.12.040", "reference_id": "PMID:20347427", "reference_ids": [ "PMID:20347427" ], "title": "Regulation of chromatin architecture by the PWWP domain-containing DNA damage-responsive factor EXPAND1/MUM1.", "authors": [ "Huen MS", "Huang J", "Leung JW", "Sy SM", "Leung KM", "Ching YP", "Tsao SW", "Chen J" ], "year": 2010, "year_values": [ 2010 ], "year_conflict": false, "journal": "Molecular cell", "doi": "10.1016/j.molcel.2009.12.040", "pmid": 20347427, "url": "https://doi.org/10.1016/j.molcel.2009.12.040", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "EXPAND1/MUM1 PWWP chromatin architecture and DNA damage response", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:20347427", "year": 2010, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.molcel.2009.12.040" } ], "proteins": [ { "protein_id": "UP:Q2TAK8", "uniprot": "Q2TAK8", "gene": "PWWP3A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.molcel.2009.12.040", "kind": "publication", "kind_label": "Publication year", "date": "2010", "sort_date": "2010-00-00" }, { "id": "DOI:10.1038/nsmb.1797", "reference_id": "PMID:20400950", "reference_ids": [ "PMID:20400950" ], "title": "Molecular basis of histone H3K36me3 recognition by the PWWP domain of Brpf1.", "authors": [ "Vezzoli A", "Bonadies N", "Allen MD", "Freund SM", "Santiveri CM", "Kvinlaug BT", "Huntly BJ", "Göttgens B", "Bycroft M" ], "year": 2010, "year_values": [ 2010 ], "year_conflict": false, "journal": "Nature structural & molecular biology", "doi": "10.1038/nsmb.1797", "pmid": 20400950, "url": "https://doi.org/10.1038/nsmb.1797", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "BRPF1 PWWP H3K36me3 molecular recognition", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:20400950", "year": 2010, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1038/nsmb.1797" } ], "proteins": [ { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2X35", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "2X4W", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "2X4X", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "2X4Y", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/nsmb.1797", "kind": "publication", "kind_label": "Publication year", "date": "2010", "sort_date": "2010-00-00" }, { "id": "DOI:10.1074/jbc.m109.089433", "reference_id": "PMID:20547484", "reference_ids": [ "PMID:20547484" ], "title": "The Dnmt3a PWWP domain reads histone 3 lysine 36 trimethylation and guides DNA methylation.", "authors": [ "Dhayalan A", "Rajavelu A", "Rathert P", "Tamas R", "Jurkowska RZ", "Ragozin S", "Jeltsch A" ], "year": 2010, "year_values": [ 2010 ], "year_conflict": false, "journal": "The Journal of biological chemistry", "doi": "10.1074/jbc.m109.089433", "pmid": 20547484, "url": "https://doi.org/10.1074/jbc.m109.089433", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "DNMT3A PWWP reading of H3K36me3", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:20547484", "year": 2010, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1074/jbc.m109.089433" } ], "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1074/jbc.m109.089433", "kind": "publication", "kind_label": "Publication year", "date": "2010", "sort_date": "2010-00-00" }, { "event_id": "PDB:3L42:release", "id": "3L42", "kind": "release", "kind_label": "PDB initial release", "date": "2010-01-12", "sort_date": "2010-01-12", "year": 2010, "title": "PWWP domain of human bromodomain and PHD finger containing protein 1", "url": "https://www.rcsb.org/structure/3L42", "proteins": [ { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3L42", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P55201:PWWP1", "gene": "BRPF1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2010-01-12T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:2X35:deposition", "id": "2X35", "kind": "deposition", "kind_label": "PDB deposition", "date": "2010-01-21", "sort_date": "2010-01-21", "year": 2010, "title": "Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1.", "url": "https://www.rcsb.org/structure/2X35", "proteins": [ { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2X35", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P55201:PWWP1", "gene": "BRPF1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/nsmb.1797", "title": "Molecular basis of histone H3K36me3 recognition by the PWWP domain of Brpf1.", "url": "https://doi.org/10.1038/nsmb.1797", "doi": "10.1038/nsmb.1797", "pmid": 20400950, "year": 2010 } ], "date_precision": "day", "source_date": "2010-01-21T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3LLR:deposition", "id": "3LLR", "kind": "deposition", "kind_label": "PDB deposition", "date": "2010-01-29", "sort_date": "2010-01-29", "year": 2010, "title": "Crystal structure of the PWWP domain of Human DNA (cytosine-5-)-methyltransferase 3 alpha", "url": "https://www.rcsb.org/structure/3LLR", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3LLR", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2010-01-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:2X4W:deposition", "id": "2X4W", "kind": "deposition", "kind_label": "PDB deposition", "date": "2010-02-02", "sort_date": "2010-02-02", "year": 2010, "title": "Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1.", "url": "https://www.rcsb.org/structure/2X4W", "proteins": [ { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2X4W", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P55201:PWWP1", "gene": "BRPF1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/nsmb.1797", "title": "Molecular basis of histone H3K36me3 recognition by the PWWP domain of Brpf1.", "url": "https://doi.org/10.1038/nsmb.1797", "doi": "10.1038/nsmb.1797", "pmid": 20400950, "year": 2010 } ], "date_precision": "day", "source_date": "2010-02-02T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:2X4X:deposition", "id": "2X4X", "kind": "deposition", "kind_label": "PDB deposition", "date": "2010-02-02", "sort_date": "2010-02-02", "year": 2010, "title": "Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1.", "url": "https://www.rcsb.org/structure/2X4X", "proteins": [ { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2X4X", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P55201:PWWP1", "gene": "BRPF1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/nsmb.1797", "title": "Molecular basis of histone H3K36me3 recognition by the PWWP domain of Brpf1.", "url": "https://doi.org/10.1038/nsmb.1797", "doi": "10.1038/nsmb.1797", "pmid": 20400950, "year": 2010 } ], "date_precision": "day", "source_date": "2010-02-02T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:2X4Y:deposition", "id": "2X4Y", "kind": "deposition", "kind_label": "PDB deposition", "date": "2010-02-02", "sort_date": "2010-02-02", "year": 2010, "title": "Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1.", "url": "https://www.rcsb.org/structure/2X4Y", "proteins": [ { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2X4Y", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P55201:PWWP1", "gene": "BRPF1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/nsmb.1797", "title": "Molecular basis of histone H3K36me3 recognition by the PWWP domain of Brpf1.", "url": "https://doi.org/10.1038/nsmb.1797", "doi": "10.1038/nsmb.1797", "pmid": 20400950, "year": 2010 } ], "date_precision": "day", "source_date": "2010-02-02T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:2X35:release", "id": "2X35", "kind": "release", "kind_label": "PDB initial release", "date": "2010-02-02", "sort_date": "2010-02-02", "year": 2010, "title": "Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1.", "url": "https://www.rcsb.org/structure/2X35", "proteins": [ { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2X35", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P55201:PWWP1", "gene": "BRPF1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/nsmb.1797", "title": "Molecular basis of histone H3K36me3 recognition by the PWWP domain of Brpf1.", "url": "https://doi.org/10.1038/nsmb.1797", "doi": "10.1038/nsmb.1797", "pmid": 20400950, "year": 2010 } ], "date_precision": "day", "source_date": "2010-02-02T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3LYI:deposition", "id": "3LYI", "kind": "deposition", "kind_label": "PDB deposition", "date": "2010-02-26", "sort_date": "2010-02-26", "year": 2010, "title": "PWWP Domain of Human Bromodomain-Containing Protein 1", "url": "https://www.rcsb.org/structure/3LYI", "proteins": [ { "protein_id": "UP:O95696", "uniprot": "O95696", "gene": "BRD1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3LYI", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O95696:PWWP1", "gene": "BRD1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2010-02-26T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3LYI:release", "id": "3LYI", "kind": "release", "kind_label": "PDB initial release", "date": "2010-03-16", "sort_date": "2010-03-16", "year": 2010, "title": "PWWP Domain of Human Bromodomain-Containing Protein 1", "url": "https://www.rcsb.org/structure/3LYI", "proteins": [ { "protein_id": "UP:O95696", "uniprot": "O95696", "gene": "BRD1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3LYI", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O95696:PWWP1", "gene": "BRD1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2010-03-16T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3LLR:release", "id": "3LLR", "kind": "release", "kind_label": "PDB initial release", "date": "2010-03-23", "sort_date": "2010-03-23", "year": 2010, "title": "Crystal structure of the PWWP domain of Human DNA (cytosine-5-)-methyltransferase 3 alpha", "url": "https://www.rcsb.org/structure/3LLR", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3LLR", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2010-03-23T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:2X4W:release", "id": "2X4W", "kind": "release", "kind_label": "PDB initial release", "date": "2010-04-21", "sort_date": "2010-04-21", "year": 2010, "title": "Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1.", "url": "https://www.rcsb.org/structure/2X4W", "proteins": [ { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2X4W", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P55201:PWWP1", "gene": "BRPF1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/nsmb.1797", "title": "Molecular basis of histone H3K36me3 recognition by the PWWP domain of Brpf1.", "url": "https://doi.org/10.1038/nsmb.1797", "doi": "10.1038/nsmb.1797", "pmid": 20400950, "year": 2010 } ], "date_precision": "day", "source_date": "2010-04-21T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:2X4X:release", "id": "2X4X", "kind": "release", "kind_label": "PDB initial release", "date": "2010-04-21", "sort_date": "2010-04-21", "year": 2010, "title": "Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1.", "url": "https://www.rcsb.org/structure/2X4X", "proteins": [ { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2X4X", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P55201:PWWP1", "gene": "BRPF1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/nsmb.1797", "title": "Molecular basis of histone H3K36me3 recognition by the PWWP domain of Brpf1.", "url": "https://doi.org/10.1038/nsmb.1797", "doi": "10.1038/nsmb.1797", "pmid": 20400950, "year": 2010 } ], "date_precision": "day", "source_date": "2010-04-21T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:2X4Y:release", "id": "2X4Y", "kind": "release", "kind_label": "PDB initial release", "date": "2010-04-21", "sort_date": "2010-04-21", "year": 2010, "title": "Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1.", "url": "https://www.rcsb.org/structure/2X4Y", "proteins": [ { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2X4Y", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P55201:PWWP1", "gene": "BRPF1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/nsmb.1797", "title": "Molecular basis of histone H3K36me3 recognition by the PWWP domain of Brpf1.", "url": "https://doi.org/10.1038/nsmb.1797", "doi": "10.1038/nsmb.1797", "pmid": 20400950, "year": 2010 } ], "date_precision": "day", "source_date": "2010-04-21T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3MO8:deposition", "id": "3MO8", "kind": "deposition", "kind_label": "PDB deposition", "date": "2010-04-22", "sort_date": "2010-04-22", "year": 2010, "title": "PWWP Domain of Human Bromodomain and PHD finger-containing protein 1 In Complex with Trimethylated H3K36 Peptide", "url": "https://www.rcsb.org/structure/3MO8", "proteins": [ { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3MO8", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P55201:PWWP1", "gene": "BRPF1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2010-04-22T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3MO8:release", "id": "3MO8", "kind": "release", "kind_label": "PDB initial release", "date": "2010-06-02", "sort_date": "2010-06-02", "year": 2010, "title": "PWWP Domain of Human Bromodomain and PHD finger-containing protein 1 In Complex with Trimethylated H3K36 Peptide", "url": "https://www.rcsb.org/structure/3MO8", "proteins": [ { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3MO8", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P55201:PWWP1", "gene": "BRPF1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2010-06-02T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3PFS:deposition", "id": "3PFS", "kind": "deposition", "kind_label": "PDB deposition", "date": "2010-10-29", "sort_date": "2010-10-29", "year": 2010, "title": "PWWP Domain of Human Bromodomain and PHD finger-containing protein 3", "url": "https://www.rcsb.org/structure/3PFS", "proteins": [ { "protein_id": "UP:Q9ULD4", "uniprot": "Q9ULD4", "gene": "BRPF3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3PFS", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9ULD4:PWWP1", "gene": "BRPF3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2010-10-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3PFS:release", "id": "3PFS", "kind": "release", "kind_label": "PDB initial release", "date": "2010-11-10", "sort_date": "2010-11-10", "year": 2010, "title": "PWWP Domain of Human Bromodomain and PHD finger-containing protein 3", "url": "https://www.rcsb.org/structure/3PFS", "proteins": [ { "protein_id": "UP:Q9ULD4", "uniprot": "Q9ULD4", "gene": "BRPF3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3PFS", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9ULD4:PWWP1", "gene": "BRPF3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2010-11-10T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3PMI:deposition", "id": "3PMI", "kind": "deposition", "kind_label": "PDB deposition", "date": "2010-11-17", "sort_date": "2010-11-17", "year": 2010, "title": "PWWP Domain of Human Mutated Melanoma-Associated Antigen 1", "url": "https://www.rcsb.org/structure/3PMI", "proteins": [ { "protein_id": "UP:Q2TAK8", "uniprot": "Q2TAK8", "gene": "PWWP3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3PMI", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q2TAK8:PWWP1", "gene": "PWWP3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2010-11-17T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3PMI:release", "id": "3PMI", "kind": "release", "kind_label": "PDB initial release", "date": "2010-12-15", "sort_date": "2010-12-15", "year": 2010, "title": "PWWP Domain of Human Mutated Melanoma-Associated Antigen 1", "url": "https://www.rcsb.org/structure/3PMI", "proteins": [ { "protein_id": "UP:Q2TAK8", "uniprot": "Q2TAK8", "gene": "PWWP3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3PMI", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q2TAK8:PWWP1", "gene": "PWWP3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2010-12-15T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1371/journal.pone.0018919", "reference_id": "PMID:21720545", "reference_ids": [ "PMID:21720545" ], "title": "Structural and histone binding ability characterizations of human PWWP domains.", "authors": [ "Wu H", "Zeng H", "Lam R", "Tempel W", "Amaya MF", "Xu C", "Dombrovski L", "Qiu W", "Wang Y", "Min J" ], "year": 2011, "year_values": [ 2011 ], "year_conflict": false, "journal": "PloS one", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "url": "https://doi.org/10.1371/journal.pone.0018919", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Family-wide human PWWP structure and histone binding comparison", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:21720545", "year": 2011, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1371/journal.pone.0018919" } ], "proteins": [ { "protein_id": "UP:O95696", "uniprot": "O95696", "gene": "BRD1", "organism": "Homo sapiens" }, { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" }, { "protein_id": "UP:Q2TAK8", "uniprot": "Q2TAK8", "gene": "PWWP3A", "organism": "Homo sapiens" }, { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9ULD4", "uniprot": "Q9ULD4", "gene": "BRPF3", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3EAE", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3L42", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3LLR", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3LYI", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3MO8", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3PFS", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3PMI", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3QBY", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3QJ6", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3QKJ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" }, { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" }, { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [ { "name": "Bis-Tris", "preparation_id": "PREP:BIS-TRIS", "chemical_identity_status": "exact_single_CCD_identity", "assay_ids": [ "PWWP:ASSAY:0033", "PWWP:ASSAY:0034" ], "evidence_classes": [ "structural_occupancy_association" ], "domain_ids": [ "UP:Q9UBC3:PWWP1", "UP:Q9Y6K1:PWWP1" ] }, { "name": "H4K20me3 peptide / trimethyllysine monomer", "preparation_id": "PREP:H4K20me3_11mer", "chemical_identity_status": "defined_modified_peptide_sequence_not_monomer_identity", "assay_ids": [ "PWWP11:ASSAY:0010", "PWWP:ASSAY:0036" ], "evidence_classes": [ "qualitative_weak_binding", "structural_occupancy_association" ], "domain_ids": [ "UP:Q7Z4V5:PWWP1" ] } ], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1371/journal.pone.0018919", "kind": "publication", "kind_label": "Publication year", "date": "2011", "sort_date": "2011-00-00" }, { "event_id": "PDB:2L89:deposition", "id": "2L89", "kind": "deposition", "kind_label": "PDB deposition", "date": "2011-01-07", "sort_date": "2011-01-07", "year": 2011, "title": "Solution structure of Pdp1 PWWP domain reveals its unique binding sites for methylated H4K20 and DNA", "url": "https://www.rcsb.org/structure/2L89", "proteins": [ { "protein_id": "UP:O59676", "uniprot": "O59676", "gene": "pdp1", "organism": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)" } ], "structures": [ { "pdb_id": "2L89", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O59676:PWWP1", "gene": "pdp1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1042/bj20111885", "title": "Solution structure of the Pdp1 PWWP domain reveals its unique binding sites for methylated H4K20 and DNA.", "url": "https://doi.org/10.1042/bj20111885", "doi": "10.1042/bj20111885", "pmid": 22150589, "year": 2012 } ], "date_precision": "day", "source_date": "2011-01-07T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3QBY:deposition", "id": "3QBY", "kind": "deposition", "kind_label": "PDB deposition", "date": "2011-01-14", "sort_date": "2011-01-14", "year": 2011, "title": "Crystal structure of the PWWP domain of human Hepatoma-derived growth factor 2", "url": "https://www.rcsb.org/structure/3QBY", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3QBY", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2011-01-14T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3QJ6:deposition", "id": "3QJ6", "kind": "deposition", "kind_label": "PDB deposition", "date": "2011-01-28", "sort_date": "2011-01-28", "year": 2011, "title": "The crystal structure of PWWP domain of human Hepatoma-derived growth factor 2 in complex with H3K79me3 peptide", "url": "https://www.rcsb.org/structure/3QJ6", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3QJ6", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2011-01-28T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3QKJ:deposition", "id": "3QKJ", "kind": "deposition", "kind_label": "PDB deposition", "date": "2011-02-01", "sort_date": "2011-02-01", "year": 2011, "title": "The PWWP domain of human DNA (CYTOSINE-5-)-METHYLTRANSFERASE 3 BETA in complex with a bis-tris molecule", "url": "https://www.rcsb.org/structure/3QKJ", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3QKJ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2011-02-01T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3QBY:release", "id": "3QBY", "kind": "release", "kind_label": "PDB initial release", "date": "2011-02-09", "sort_date": "2011-02-09", "year": 2011, "title": "Crystal structure of the PWWP domain of human Hepatoma-derived growth factor 2", "url": "https://www.rcsb.org/structure/3QBY", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3QBY", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2011-02-09T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3QJ6:release", "id": "3QJ6", "kind": "release", "kind_label": "PDB initial release", "date": "2011-02-23", "sort_date": "2011-02-23", "year": 2011, "title": "The crystal structure of PWWP domain of human Hepatoma-derived growth factor 2 in complex with H3K79me3 peptide", "url": "https://www.rcsb.org/structure/3QJ6", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3QJ6", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2011-02-23T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3QKJ:release", "id": "3QKJ", "kind": "release", "kind_label": "PDB initial release", "date": "2011-03-09", "sort_date": "2011-03-09", "year": 2011, "title": "The PWWP domain of human DNA (CYTOSINE-5-)-METHYLTRANSFERASE 3 BETA in complex with a bis-tris molecule", "url": "https://www.rcsb.org/structure/3QKJ", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3QKJ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1371/journal.pone.0018919", "title": "Structural and histone binding ability characterizations of human PWWP domains.", "url": "https://doi.org/10.1371/journal.pone.0018919", "doi": "10.1371/journal.pone.0018919", "pmid": 21720545, "year": 2011 } ], "date_precision": "day", "source_date": "2011-03-09T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:2L89:release", "id": "2L89", "kind": "release", "kind_label": "PDB initial release", "date": "2011-12-21", "sort_date": "2011-12-21", "year": 2011, "title": "Solution structure of Pdp1 PWWP domain reveals its unique binding sites for methylated H4K20 and DNA", "url": "https://www.rcsb.org/structure/2L89", "proteins": [ { "protein_id": "UP:O59676", "uniprot": "O59676", "gene": "pdp1", "organism": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)" } ], "structures": [ { "pdb_id": "2L89", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O59676:PWWP1", "gene": "pdp1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1042/bj20111885", "title": "Solution structure of the Pdp1 PWWP domain reveals its unique binding sites for methylated H4K20 and DNA.", "url": "https://doi.org/10.1042/bj20111885", "doi": "10.1042/bj20111885", "pmid": 22150589, "year": 2012 } ], "date_precision": "day", "source_date": "2011-12-21T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1042/bj20111885", "reference_id": "PMID:22150589", "reference_ids": [ "PMID:22150589" ], "title": "Solution structure of the Pdp1 PWWP domain reveals its unique binding sites for methylated H4K20 and DNA.", "authors": [ "Qiu Y", "Zhang W", "Zhao C", "Wang Y", "Wang W", "Zhang J", "Zhang Z", "Li G", "Shi Y", "Tu X", "Wu J" ], "year": 2012, "year_values": [ 2012 ], "year_conflict": false, "journal": "The Biochemical journal", "doi": "10.1042/bj20111885", "pmid": 22150589, "url": "https://doi.org/10.1042/bj20111885", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Pdp1 PWWP solution structure and H4K20/DNA binding sites", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:22150589", "year": 2012, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1042/bj20111885" } ], "proteins": [ { "protein_id": "UP:O59676", "uniprot": "O59676", "gene": "pdp1", "organism": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)" } ], "structures": [ { "pdb_id": "2L89", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1042/bj20111885", "kind": "publication", "kind_label": "Publication year", "date": "2012", "sort_date": "2012-00-00" }, { "id": "DOI:10.1074/jbc.m111.299149", "reference_id": "PMID:22247551", "reference_ids": [ "PMID:22247551" ], "title": "Structural insight into recognition of methylated histone tails by retinoblastoma-binding protein 1.", "authors": [ "Gong W", "Zhou T", "Mo J", "Perrett S", "Wang J", "Feng Y" ], "year": 2012, "year_values": [ 2012 ], "year_conflict": false, "journal": "The Journal of biological chemistry", "doi": "10.1074/jbc.m111.299149", "pmid": 22247551, "url": "https://doi.org/10.1074/jbc.m111.299149", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Royal-family domain comparison in ARID4A; chromobarrel coordinate 2LCC is not a PWWP structure", "verification_level": "primary_abstract_and_structural_metadata_verified", "source_records": [ { "reference_id": "PMID:22247551", "year": 2012, "source_type": "primary_experimental_research", "verification_level": "primary_abstract_and_structural_metadata_verified", "url": "https://doi.org/10.1074/jbc.m111.299149" } ], "proteins": [ { "protein_id": "UP:P29374", "uniprot": "P29374", "gene": "ARID4A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1074/jbc.m111.299149", "kind": "publication", "kind_label": "Publication year", "date": "2012", "sort_date": "2012-00-00" }, { "id": "DOI:10.1186/1471-2148-12-101", "reference_id": "PMID:22734652", "reference_ids": [ "PMID:22734652" ], "title": "Evolution of the PWWP-domain encoding genes in the plant and animal lineages.", "authors": [ "Alvarez-Venegas R", "Avramova Z" ], "year": 2012, "year_values": [ 2012 ], "year_conflict": false, "journal": "BMC evolutionary biology", "doi": "10.1186/1471-2148-12-101", "pmid": 22734652, "url": "https://doi.org/10.1186/1471-2148-12-101", "source_type": "primary_sequence_analysis", "citation_role": "pwwp_research_context", "citation_role_label": "Comparative sequence research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Comparative evolution of PWWP-domain genes in animal and plant lineages", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "source_records": [ { "reference_id": "PMID:22734652", "year": 2012, "source_type": "primary_sequence_analysis", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "url": "https://doi.org/10.1186/1471-2148-12-101" } ], "proteins": [], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1186/1471-2148-12-101", "kind": "publication", "kind_label": "Publication year", "date": "2012", "sort_date": "2012-00-00" }, { "event_id": "PDB:4FU6:deposition", "id": "4FU6", "kind": "deposition", "kind_label": "PDB deposition", "date": "2012-06-28", "sort_date": "2012-06-28", "year": 2012, "title": "Crystal structure of the PSIP1 PWWP domain", "url": "https://www.rcsb.org/structure/4FU6", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4FU6", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.tibs.2014.09.001", "title": "Structure and function of the nucleosome-binding PWWP domain.", "url": "https://doi.org/10.1016/j.tibs.2014.09.001", "doi": "10.1016/j.tibs.2014.09.001", "pmid": 25277115, "year": 2014 } ], "date_precision": "day", "source_date": "2012-06-28T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:4FU6:release", "id": "4FU6", "kind": "release", "kind_label": "PDB initial release", "date": "2012-08-29", "sort_date": "2012-08-29", "year": 2012, "title": "Crystal structure of the PSIP1 PWWP domain", "url": "https://www.rcsb.org/structure/4FU6", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4FU6", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.tibs.2014.09.001", "title": "Structure and function of the nucleosome-binding PWWP domain.", "url": "https://doi.org/10.1016/j.tibs.2014.09.001", "doi": "10.1016/j.tibs.2014.09.001", "pmid": 25277115, "year": 2014 } ], "date_precision": "day", "source_date": "2012-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:2M16:deposition", "id": "2M16", "kind": "deposition", "kind_label": "PDB deposition", "date": "2012-11-18", "sort_date": "2012-11-18", "year": 2012, "title": "P75/LEDGF PWWP Domain", "url": "https://www.rcsb.org/structure/2M16", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2M16", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkt074", "title": "Structural basis for high-affinity binding of LEDGF PWWP to mononucleosomes.", "url": "https://doi.org/10.1093/nar/gkt074", "doi": "10.1093/nar/gkt074", "pmid": 23396443, "year": 2013 } ], "date_precision": "day", "source_date": "2012-11-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3ZEH:deposition", "id": "3ZEH", "kind": "deposition", "kind_label": "PDB deposition", "date": "2012-12-05", "sort_date": "2012-12-05", "year": 2012, "title": "Solution structure of the Hs. PSIP1 PWWP domain", "url": "https://www.rcsb.org/structure/3ZEH", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3ZEH", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1186/1756-8935-6-12", "title": "Nucleosomal DNA binding drives the recognition of H3K36-methylated nucleosomes by the PSIP1-PWWP domain.", "url": "https://doi.org/10.1186/1756-8935-6-12", "doi": "10.1186/1756-8935-6-12", "pmid": 23656834, "year": 2013 } ], "date_precision": "day", "source_date": "2012-12-05T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1016/j.cell.2013.03.025", "reference_id": "PMID:23622243", "reference_ids": [ "PMID:23622243" ], "title": "The histone mark H3K36me3 regulates human DNA mismatch repair through its interaction with MutSα.", "authors": [ "Li F", "Mao G", "Tong D", "Huang J", "Gu L", "Yang W", "Li GM" ], "year": 2013, "year_values": [ 2013 ], "year_conflict": false, "journal": "Cell", "doi": "10.1016/j.cell.2013.03.025", "pmid": 23622243, "url": "https://doi.org/10.1016/j.cell.2013.03.025", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "H3K36me3 recognition and human mismatch repair", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:23622243", "year": 2013, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.cell.2013.03.025" } ], "proteins": [ { "protein_id": "UP:P52701", "uniprot": "P52701", "gene": "MSH6", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.cell.2013.03.025", "kind": "publication", "kind_label": "Publication year", "date": "2013", "sort_date": "2013-00-00" }, { "id": "DOI:10.1093/nar/gkt074", "reference_id": "PMID:23396443", "reference_ids": [ "PMID:23396443" ], "title": "Structural basis for high-affinity binding of LEDGF PWWP to mononucleosomes.", "authors": [ "Eidahl JO", "Crowe BL", "North JA", "McKee CJ", "Shkriabai N", "Feng L", "Plumb M", "Graham RL", "Gorelick RJ", "Hess S", "Poirier MG", "Foster MP", "Kvaratskhelia M" ], "year": 2013, "year_values": [ 2013 ], "year_conflict": false, "journal": "Nucleic acids research", "doi": "10.1093/nar/gkt074", "pmid": 23396443, "url": "https://doi.org/10.1093/nar/gkt074", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "LEDGF PWWP solution structure and cooperative nucleosome recognition", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:23396443", "year": 2013, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1093/nar/gkt074" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2M16", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1093/nar/gkt074", "kind": "publication", "kind_label": "Publication year", "date": "2013", "sort_date": "2013-00-00" }, { "id": "DOI:10.1186/1756-8935-6-12", "reference_id": "PMID:23656834", "reference_ids": [ "PMID:23656834" ], "title": "Nucleosomal DNA binding drives the recognition of H3K36-methylated nucleosomes by the PSIP1-PWWP domain.", "authors": [ "van Nuland R", "van Schaik FM", "Simonis M", "van Heesch S", "Cuppen E", "Boelens R", "Timmers HM", "van Ingen H" ], "year": 2013, "year_values": [ 2013 ], "year_conflict": false, "journal": "Epigenetics & chromatin", "doi": "10.1186/1756-8935-6-12", "pmid": 23656834, "url": "https://doi.org/10.1186/1756-8935-6-12", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Nucleosomal DNA contribution to PSIP1 PWWP recognition", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:23656834", "year": 2013, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1186/1756-8935-6-12" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3ZEH", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "3ZH1", "in_atlas": false, "observed_pwwp": null } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1186/1756-8935-6-12", "kind": "publication", "kind_label": "Publication year", "date": "2013", "sort_date": "2013-00-00" }, { "id": "DOI:10.1371/journal.pone.0081217", "reference_id": "PMID:24312278", "reference_ids": [ "PMID:24312278" ], "title": "TOX4 and NOVA1 proteins are partners of the LEDGF PWWP domain and affect HIV-1 replication.", "authors": [ "Morchikh M", "Naughtin M", "Di Nunzio F", "Xavier J", "Charneau P", "Jacob Y", "Lavigne M" ], "year": 2013, "year_values": [ 2013 ], "year_conflict": false, "journal": "PloS one", "doi": "10.1371/journal.pone.0081217", "pmid": 24312278, "url": "https://doi.org/10.1371/journal.pone.0081217", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "TOX4 and NOVA1 as LEDGF PWWP interaction partners", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "source_records": [ { "reference_id": "PMID:24312278", "year": 2013, "source_type": "primary_experimental_research", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "url": "https://doi.org/10.1371/journal.pone.0081217" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1371/journal.pone.0081217", "kind": "publication", "kind_label": "Publication year", "date": "2013", "sort_date": "2013-00-00" }, { "event_id": "PDB:2M16:release", "id": "2M16", "kind": "release", "kind_label": "PDB initial release", "date": "2013-02-27", "sort_date": "2013-02-27", "year": 2013, "title": "P75/LEDGF PWWP Domain", "url": "https://www.rcsb.org/structure/2M16", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "2M16", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkt074", "title": "Structural basis for high-affinity binding of LEDGF PWWP to mononucleosomes.", "url": "https://doi.org/10.1093/nar/gkt074", "doi": "10.1093/nar/gkt074", "pmid": 23396443, "year": 2013 } ], "date_precision": "day", "source_date": "2013-02-27T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:3ZEH:release", "id": "3ZEH", "kind": "release", "kind_label": "PDB initial release", "date": "2013-05-22", "sort_date": "2013-05-22", "year": 2013, "title": "Solution structure of the Hs. PSIP1 PWWP domain", "url": "https://www.rcsb.org/structure/3ZEH", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "3ZEH", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1186/1756-8935-6-12", "title": "Nucleosomal DNA binding drives the recognition of H3K36-methylated nucleosomes by the PSIP1-PWWP domain.", "url": "https://doi.org/10.1186/1756-8935-6-12", "doi": "10.1186/1756-8935-6-12", "pmid": 23656834, "year": 2013 } ], "date_precision": "day", "source_date": "2013-05-22T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:4LD6:deposition", "id": "4LD6", "kind": "deposition", "kind_label": "PDB deposition", "date": "2013-06-24", "sort_date": "2013-06-24", "year": 2013, "title": "PWWP domain of human PWWP Domain-Containing Protein 2B", "url": "https://www.rcsb.org/structure/4LD6", "proteins": [ { "protein_id": "UP:Q6NUJ5", "uniprot": "Q6NUJ5", "gene": "PWWP2B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4LD6", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q6NUJ5:PWWP1", "gene": "PWWP2B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:4LD6:primary", "title": "Crystal structure of PWWP domain of human PWWP Domain-Containing Protein 2B", "url": "https://www.rcsb.org/structure/4LD6", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2013-06-24T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:4LD6:release", "id": "4LD6", "kind": "release", "kind_label": "PDB initial release", "date": "2013-07-17", "sort_date": "2013-07-17", "year": 2013, "title": "PWWP domain of human PWWP Domain-Containing Protein 2B", "url": "https://www.rcsb.org/structure/4LD6", "proteins": [ { "protein_id": "UP:Q6NUJ5", "uniprot": "Q6NUJ5", "gene": "PWWP2B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4LD6", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q6NUJ5:PWWP1", "gene": "PWWP2B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:4LD6:primary", "title": "Crystal structure of PWWP domain of human PWWP Domain-Containing Protein 2B", "url": "https://www.rcsb.org/structure/4LD6", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2013-07-17T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:4N4G:deposition", "id": "4N4G", "kind": "deposition", "kind_label": "PDB deposition", "date": "2013-10-08", "sort_date": "2013-10-08", "year": 2013, "title": "Crystal structure of the Bromo-PWWP of the mouse zinc finger MYND-type containing 11 isoform alpha", "url": "https://www.rcsb.org/structure/4N4G", "proteins": [ { "protein_id": "UP:Q8R5C8", "uniprot": "Q8R5C8", "gene": "Zmynd11", "organism": "Mus musculus" } ], "structures": [ { "pdb_id": "4N4G", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q8R5C8:PWWP1", "gene": "Zmynd11", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/nature13045", "title": "ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression.", "url": "https://doi.org/10.1038/nature13045", "doi": "10.1038/nature13045", "pmid": 24590075, "year": 2014 } ], "date_precision": "day", "source_date": "2013-10-08T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:4N4H:deposition", "id": "4N4H", "kind": "deposition", "kind_label": "PDB deposition", "date": "2013-10-08", "sort_date": "2013-10-08", "year": 2013, "title": "Crystal structure of the Bromo-PWWP of the mouse zinc finger MYND-type containing 11 isoform alpha in complex with histone H3.1K36me3", "url": "https://www.rcsb.org/structure/4N4H", "proteins": [ { "protein_id": "UP:Q8R5C8", "uniprot": "Q8R5C8", "gene": "Zmynd11", "organism": "Mus musculus" } ], "structures": [ { "pdb_id": "4N4H", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q8R5C8:PWWP1", "gene": "Zmynd11", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/nature13045", "title": "ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression.", "url": "https://doi.org/10.1038/nature13045", "doi": "10.1038/nature13045", "pmid": 24590075, "year": 2014 } ], "date_precision": "day", "source_date": "2013-10-08T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:4N4I:deposition", "id": "4N4I", "kind": "deposition", "kind_label": "PDB deposition", "date": "2013-10-08", "sort_date": "2013-10-08", "year": 2013, "title": "Crystal structure of the Bromo-PWWP of the mouse zinc finger MYND-type containing 11 isoform alpha in complex with histone H3.3K36me3", "url": "https://www.rcsb.org/structure/4N4I", "proteins": [ { "protein_id": "UP:Q8R5C8", "uniprot": "Q8R5C8", "gene": "Zmynd11", "organism": "Mus musculus" } ], "structures": [ { "pdb_id": "4N4I", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q8R5C8:PWWP1", "gene": "Zmynd11", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/nature13045", "title": "ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression.", "url": "https://doi.org/10.1038/nature13045", "doi": "10.1038/nature13045", "pmid": 24590075, "year": 2014 } ], "date_precision": "day", "source_date": "2013-10-08T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:4NS5:deposition", "id": "4NS5", "kind": "deposition", "kind_label": "PDB deposition", "date": "2013-11-28", "sort_date": "2013-11-28", "year": 2013, "title": "Crystal structure of human BS69 Bromo-Zinc finger-PWWP", "url": "https://www.rcsb.org/structure/4NS5", "proteins": [ { "protein_id": "UP:Q15326", "uniprot": "Q15326", "gene": "ZMYND11", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4NS5", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q15326:PWWP1", "gene": "ZMYND11", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/cr.2014.38", "title": "Crystal structure of human BS69 Bromo-ZnF-PWWP reveals its role in H3K36me3 nucleosome binding.", "url": "https://doi.org/10.1038/cr.2014.38", "doi": "10.1038/cr.2014.38", "pmid": 24675531, "year": 2014 } ], "date_precision": "day", "source_date": "2013-11-28T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1016/j.molcel.2014.08.022", "reference_id": "PMID:25263594", "reference_ids": [ "PMID:25263594" ], "title": "BS69/ZMYND11 reads and connects histone H3.3 lysine 36 trimethylation-decorated chromatin to regulated pre-mRNA processing.", "authors": [ "Guo R", "Zheng L", "Park JW", "Lv R", "Chen H", "Jiao F", "Xu W", "Mu S", "Wen H", "Qiu J", "Wang Z", "Yang P", "Wu F", "Hui J", "Fu X", "Shi X", "Shi YG", "Xing Y", "Lan F", "Shi Y" ], "year": 2014, "year_values": [ 2014 ], "year_conflict": false, "journal": "Molecular cell", "doi": "10.1016/j.molcel.2014.08.022", "pmid": 25263594, "url": "https://doi.org/10.1016/j.molcel.2014.08.022", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Histone H3.3 recognition coupled to pre-mRNA processing", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:25263594", "year": 2014, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.molcel.2014.08.022" } ], "proteins": [ { "protein_id": "UP:Q15326", "uniprot": "Q15326", "gene": "ZMYND11", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.molcel.2014.08.022", "kind": "publication", "kind_label": "Publication year", "date": "2014", "sort_date": "2014-00-00" }, { "id": "DOI:10.1016/j.tibs.2014.09.001", "reference_id": "PMID:25277115", "reference_ids": [ "PMID:25277115" ], "title": "Structure and function of the nucleosome-binding PWWP domain.", "authors": [ "Qin S", "Min J" ], "year": 2014, "year_values": [ 2014 ], "year_conflict": false, "journal": "Trends in biochemical sciences", "doi": "10.1016/j.tibs.2014.09.001", "pmid": 25277115, "url": "https://doi.org/10.1016/j.tibs.2014.09.001", "source_type": "review", "citation_role": "pwwp_research_context", "citation_role_label": "Review / synthesis", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Nucleosome-binding PWWP domain review", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:25277115", "year": 2014, "source_type": "review", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.tibs.2014.09.001" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4FU6", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.tibs.2014.09.001", "kind": "publication", "kind_label": "Publication year", "date": "2014", "sort_date": "2014-00-00" }, { "id": "DOI:10.1038/cr.2014.38", "reference_id": "PMID:24675531", "reference_ids": [ "PMID:24675531" ], "title": "Crystal structure of human BS69 Bromo-ZnF-PWWP reveals its role in H3K36me3 nucleosome binding.", "authors": [ "Wang J", "Qin S", "Li F", "Li S", "Zhang W", "Peng J", "Zhang Z", "Gong Q", "Wu J", "Shi Y" ], "year": 2014, "year_values": [ 2014 ], "year_conflict": false, "journal": "Cell research", "doi": "10.1038/cr.2014.38", "pmid": 24675531, "url": "https://doi.org/10.1038/cr.2014.38", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "BS69 Bromo-ZnF-PWWP structure and nucleosome recognition", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:24675531", "year": 2014, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1038/cr.2014.38" } ], "proteins": [ { "protein_id": "UP:Q15326", "uniprot": "Q15326", "gene": "ZMYND11", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4NS5", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/cr.2014.38", "kind": "publication", "kind_label": "Publication year", "date": "2014", "sort_date": "2014-00-00" }, { "id": "DOI:10.1038/nature13045", "reference_id": "PMID:24590075", "reference_ids": [ "PMID:24590075" ], "title": "ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression.", "authors": [ "Wen H", "Li Y", "Xi Y", "Jiang S", "Stratton S", "Peng D", "Tanaka K", "Ren Y", "Xia Z", "Wu J", "Li B", "Barton MC", "Li W", "Li H", "Shi X" ], "year": 2014, "year_values": [ 2014 ], "year_conflict": false, "journal": "Nature", "doi": "10.1038/nature13045", "pmid": 24590075, "url": "https://doi.org/10.1038/nature13045", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Histone variant H3.3K36me3 recognition and tumor suppression", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:24590075", "year": 2014, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1038/nature13045" } ], "proteins": [ { "protein_id": "UP:Q15326", "uniprot": "Q15326", "gene": "ZMYND11", "organism": "Homo sapiens" }, { "protein_id": "UP:Q8R5C8", "uniprot": "Q8R5C8", "gene": "Zmynd11", "organism": "Mus musculus" } ], "structures": [ { "pdb_id": "4N4G", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "4N4H", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "4N4I", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/nature13045", "kind": "publication", "kind_label": "Publication year", "date": "2014", "sort_date": "2014-00-00" }, { "id": "DOI:10.1074/mcp.m114.038224", "reference_id": "PMID:25104842", "reference_ids": [ "PMID:25104842" ], "title": "A PWWP domain-containing protein targets the NuA3 acetyltransferase complex via histone H3 lysine 36 trimethylation to coordinate transcriptional elongation at coding regions.", "authors": [ "Gilbert TM", "McDaniel SL", "Byrum SD", "Cades JA", "Dancy BC", "Wade H", "Tackett AJ", "Strahl BD", "Taverna SD" ], "year": 2014, "year_values": [ 2014 ], "year_conflict": false, "journal": "Molecular & cellular proteomics : MCP", "doi": "10.1074/mcp.m114.038224", "pmid": 25104842, "url": "https://doi.org/10.1074/mcp.m114.038224", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Yeast PWWP targeting of NuA3 to H3K36me3", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:25104842", "year": 2014, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1074/mcp.m114.038224" } ], "proteins": [], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1074/mcp.m114.038224", "kind": "publication", "kind_label": "Publication year", "date": "2014", "sort_date": "2014-00-00" }, { "event_id": "PDB:4COS:deposition", "id": "4COS", "kind": "deposition", "kind_label": "PDB deposition", "date": "2014-01-30", "sort_date": "2014-01-30", "year": 2014, "title": "Crystal structure of the PHD-Bromo-PWWP cassette of human PRKCBP1", "url": "https://www.rcsb.org/structure/4COS", "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4COS", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9ULU4:PWWP1", "gene": "ZMYND8", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.celrep.2016.11.014", "title": "Multivalent Histone and DNA Engagement by a PHD/BRD/PWWP Triple Reader Cassette Recruits ZMYND8 to K14ac-Rich Chromatin.", "url": "https://doi.org/10.1016/j.celrep.2016.11.014", "doi": "10.1016/j.celrep.2016.11.014", "pmid": 27926874, "year": 2016 } ], "date_precision": "day", "source_date": "2014-01-30T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:4COS:release", "id": "4COS", "kind": "release", "kind_label": "PDB initial release", "date": "2014-03-05", "sort_date": "2014-03-05", "year": 2014, "title": "Crystal structure of the PHD-Bromo-PWWP cassette of human PRKCBP1", "url": "https://www.rcsb.org/structure/4COS", "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4COS", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9ULU4:PWWP1", "gene": "ZMYND8", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.celrep.2016.11.014", "title": "Multivalent Histone and DNA Engagement by a PHD/BRD/PWWP Triple Reader Cassette Recruits ZMYND8 to K14ac-Rich Chromatin.", "url": "https://doi.org/10.1016/j.celrep.2016.11.014", "doi": "10.1016/j.celrep.2016.11.014", "pmid": 27926874, "year": 2016 } ], "date_precision": "day", "source_date": "2014-03-05T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:4N4G:release", "id": "4N4G", "kind": "release", "kind_label": "PDB initial release", "date": "2014-03-05", "sort_date": "2014-03-05", "year": 2014, "title": "Crystal structure of the Bromo-PWWP of the mouse zinc finger MYND-type containing 11 isoform alpha", "url": "https://www.rcsb.org/structure/4N4G", "proteins": [ { "protein_id": "UP:Q8R5C8", "uniprot": "Q8R5C8", "gene": "Zmynd11", "organism": "Mus musculus" } ], "structures": [ { "pdb_id": "4N4G", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q8R5C8:PWWP1", "gene": "Zmynd11", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/nature13045", "title": "ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression.", "url": "https://doi.org/10.1038/nature13045", "doi": "10.1038/nature13045", "pmid": 24590075, "year": 2014 } ], "date_precision": "day", "source_date": "2014-03-05T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:4N4H:release", "id": "4N4H", "kind": "release", "kind_label": "PDB initial release", "date": "2014-03-05", "sort_date": "2014-03-05", "year": 2014, "title": "Crystal structure of the Bromo-PWWP of the mouse zinc finger MYND-type containing 11 isoform alpha in complex with histone H3.1K36me3", "url": "https://www.rcsb.org/structure/4N4H", "proteins": [ { "protein_id": "UP:Q8R5C8", "uniprot": "Q8R5C8", "gene": "Zmynd11", "organism": "Mus musculus" } ], "structures": [ { "pdb_id": "4N4H", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q8R5C8:PWWP1", "gene": "Zmynd11", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/nature13045", "title": "ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression.", "url": "https://doi.org/10.1038/nature13045", "doi": "10.1038/nature13045", "pmid": 24590075, "year": 2014 } ], "date_precision": "day", "source_date": "2014-03-05T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:4N4I:release", "id": "4N4I", "kind": "release", "kind_label": "PDB initial release", "date": "2014-03-05", "sort_date": "2014-03-05", "year": 2014, "title": "Crystal structure of the Bromo-PWWP of the mouse zinc finger MYND-type containing 11 isoform alpha in complex with histone H3.3K36me3", "url": "https://www.rcsb.org/structure/4N4I", "proteins": [ { "protein_id": "UP:Q8R5C8", "uniprot": "Q8R5C8", "gene": "Zmynd11", "organism": "Mus musculus" } ], "structures": [ { "pdb_id": "4N4I", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q8R5C8:PWWP1", "gene": "Zmynd11", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/nature13045", "title": "ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression.", "url": "https://doi.org/10.1038/nature13045", "doi": "10.1038/nature13045", "pmid": 24590075, "year": 2014 } ], "date_precision": "day", "source_date": "2014-03-05T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:4NS5:release", "id": "4NS5", "kind": "release", "kind_label": "PDB initial release", "date": "2014-04-09", "sort_date": "2014-04-09", "year": 2014, "title": "Crystal structure of human BS69 Bromo-Zinc finger-PWWP", "url": "https://www.rcsb.org/structure/4NS5", "proteins": [ { "protein_id": "UP:Q15326", "uniprot": "Q15326", "gene": "ZMYND11", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4NS5", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q15326:PWWP1", "gene": "ZMYND11", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/cr.2014.38", "title": "Crystal structure of human BS69 Bromo-ZnF-PWWP reveals its role in H3K36me3 nucleosome binding.", "url": "https://doi.org/10.1038/cr.2014.38", "doi": "10.1038/cr.2014.38", "pmid": 24675531, "year": 2014 } ], "date_precision": "day", "source_date": "2014-04-09T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:4RXJ:deposition", "id": "4RXJ", "kind": "deposition", "kind_label": "PDB deposition", "date": "2014-12-11", "sort_date": "2014-12-11", "year": 2014, "title": "crystal structure of WHSC1L1-PWWP2", "url": "https://www.rcsb.org/structure/4RXJ", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4RXJ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP2", "gene": "NSD3", "domain_name": "PWWP2" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.bbrc.2021.07.017", "title": "Histone and DNA binding ability studies of the NSD subfamily of PWWP domains.", "url": "https://doi.org/10.1016/j.bbrc.2021.07.017", "doi": "10.1016/j.bbrc.2021.07.017", "pmid": 34271259, "year": 2021 } ], "date_precision": "day", "source_date": "2014-12-11T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1021/acs.biochem.5b00454", "reference_id": "PMID:26067205", "reference_ids": [ "PMID:26067205" ], "title": "The First Residue of the PWWP Motif Modulates HATH Domain Binding, Stability, and Protein-Protein Interaction.", "authors": [ "Hung YL", "Lee HJ", "Jiang I", "Lin SC", "Lo WC", "Lin YJ", "Sue SC" ], "year": 2015, "year_values": [ 2015 ], "year_conflict": false, "journal": "Biochemistry", "doi": "10.1021/acs.biochem.5b00454", "pmid": 26067205, "url": "https://doi.org/10.1021/acs.biochem.5b00454", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP motif first-residue contribution to HATH binding and stability", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:26067205", "year": 2015, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1021/acs.biochem.5b00454" } ], "proteins": [ { "protein_id": "UP:P51858", "uniprot": "P51858", "gene": "HDGF", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1021/acs.biochem.5b00454", "kind": "publication", "kind_label": "Publication year", "date": "2015", "sort_date": "2015-00-00" }, { "event_id": "PDB:4RXJ:release", "id": "4RXJ", "kind": "release", "kind_label": "PDB initial release", "date": "2015-01-28", "sort_date": "2015-01-28", "year": 2015, "title": "crystal structure of WHSC1L1-PWWP2", "url": "https://www.rcsb.org/structure/4RXJ", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4RXJ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP2", "gene": "NSD3", "domain_name": "PWWP2" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.bbrc.2021.07.017", "title": "Histone and DNA binding ability studies of the NSD subfamily of PWWP domains.", "url": "https://doi.org/10.1016/j.bbrc.2021.07.017", "doi": "10.1016/j.bbrc.2021.07.017", "pmid": 34271259, "year": 2021 } ], "date_precision": "day", "source_date": "2015-01-28T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:4Z02:deposition", "id": "4Z02", "kind": "deposition", "kind_label": "PDB deposition", "date": "2015-03-25", "sort_date": "2015-03-25", "year": 2015, "title": "Crystal structure of BRD1 in complex with Isoquinoline-3-carboxylic acid", "url": "https://www.rcsb.org/structure/4Z02", "proteins": [ { "protein_id": "UP:O95696", "uniprot": "O95696", "gene": "BRD1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4Z02", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O95696:PWWP1", "gene": "BRD1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:4Z02:primary", "title": "Crystal structure of BRD1 incomplex with Isoquinoline-3-carboxylic acid", "url": "https://www.rcsb.org/structure/4Z02", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2015-03-25T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:4Z02:release", "id": "4Z02", "kind": "release", "kind_label": "PDB initial release", "date": "2015-04-22", "sort_date": "2015-04-22", "year": 2015, "title": "Crystal structure of BRD1 in complex with Isoquinoline-3-carboxylic acid", "url": "https://www.rcsb.org/structure/4Z02", "proteins": [ { "protein_id": "UP:O95696", "uniprot": "O95696", "gene": "BRD1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4Z02", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O95696:PWWP1", "gene": "BRD1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:4Z02:primary", "title": "Crystal structure of BRD1 incomplex with Isoquinoline-3-carboxylic acid", "url": "https://www.rcsb.org/structure/4Z02", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2015-04-22T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5C6S:deposition", "id": "5C6S", "kind": "deposition", "kind_label": "PDB deposition", "date": "2015-06-23", "sort_date": "2015-06-23", "year": 2015, "title": "Human Bromodomain and PHD Finger Containing 1, PWWP domain in complex with XST005904a", "url": "https://www.rcsb.org/structure/5C6S", "proteins": [ { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5C6S", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P55201:PWWP1", "gene": "BRPF1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:5C6S:primary", "title": "Human Bromodomain and PHD Finger Containing 1, PWWP domain in complex with XST005904a", "url": "https://www.rcsb.org/structure/5C6S", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2015-06-23T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5CIU:deposition", "id": "5CIU", "kind": "deposition", "kind_label": "PDB deposition", "date": "2015-07-13", "sort_date": "2015-07-13", "year": 2015, "title": "Structural basis of the recognition of H3K36me3 by DNMT3B PWWP domain", "url": "https://www.rcsb.org/structure/5CIU", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5CIU", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.jsb.2016.03.013", "title": "Structural basis for recognition of histone H3K36me3 nucleosome by human de novo DNA methyltransferases 3A and 3B.", "url": "https://doi.org/10.1016/j.jsb.2016.03.013", "doi": "10.1016/j.jsb.2016.03.013", "pmid": 26993463, "year": 2016 } ], "date_precision": "day", "source_date": "2015-07-13T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5C6S:release", "id": "5C6S", "kind": "release", "kind_label": "PDB initial release", "date": "2015-07-29", "sort_date": "2015-07-29", "year": 2015, "title": "Human Bromodomain and PHD Finger Containing 1, PWWP domain in complex with XST005904a", "url": "https://www.rcsb.org/structure/5C6S", "proteins": [ { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5C6S", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P55201:PWWP1", "gene": "BRPF1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:5C6S:primary", "title": "Human Bromodomain and PHD Finger Containing 1, PWWP domain in complex with XST005904a", "url": "https://www.rcsb.org/structure/5C6S", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2015-07-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1002/prot.25035", "reference_id": "PMID:27005948", "reference_ids": [ "PMID:27005948" ], "title": "Solution structure of TbTFIIS2-1 PWWP domain from Trypanosoma brucei.", "authors": [ "Wang R", "Zhang J", "Liao S", "Tu X" ], "year": 2016, "year_values": [ 2016 ], "year_conflict": false, "journal": "Proteins", "doi": "10.1002/prot.25035", "pmid": 27005948, "url": "https://doi.org/10.1002/prot.25035", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Trypanosoma brucei PWWP solution structure", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:27005948", "year": 2016, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1002/prot.25035" } ], "proteins": [], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1002/prot.25035", "kind": "publication", "kind_label": "Publication year", "date": "2016", "sort_date": "2016-00-00" }, { "id": "DOI:10.1007/s12551-015-0190-6", "reference_id": "PMID:28510146", "reference_ids": [ "PMID:28510146" ], "title": "PWWP domains and their modes of sensing DNA and histone methylated lysines.", "authors": [ "Rona GB", "Eleutherio ECA", "Pinheiro AS" ], "year": 2016, "year_values": [ 2016 ], "year_conflict": false, "journal": "Biophysical reviews", "doi": "10.1007/s12551-015-0190-6", "pmid": 28510146, "url": "https://doi.org/10.1007/s12551-015-0190-6", "source_type": "review", "citation_role": "pwwp_research_context", "citation_role_label": "Review / synthesis", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP DNA and methyllysine recognition review", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:28510146", "year": 2016, "source_type": "review", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1007/s12551-015-0190-6" } ], "proteins": [], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1007/s12551-015-0190-6", "kind": "publication", "kind_label": "Publication year", "date": "2016", "sort_date": "2016-00-00" }, { "id": "DOI:10.1016/j.celrep.2016.11.014", "reference_id": "PMID:27926874", "reference_ids": [ "PMID:27926874" ], "title": "Multivalent Histone and DNA Engagement by a PHD/BRD/PWWP Triple Reader Cassette Recruits ZMYND8 to K14ac-Rich Chromatin.", "authors": [ "Savitsky P", "Krojer T", "Fujisawa T", "Lambert JP", "Picaud S", "Wang CY", "Shanle EK", "Krajewski K", "Friedrichsen H", "Kanapin A", "Goding C", "Schapira M", "Samsonova A", "Strahl BD", "Gingras AC", "Filippakopoulos P" ], "year": 2016, "year_values": [ 2016 ], "year_conflict": false, "journal": "Cell reports", "doi": "10.1016/j.celrep.2016.11.014", "pmid": 27926874, "url": "https://doi.org/10.1016/j.celrep.2016.11.014", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PHD-BRD-PWWP cassette multivalent histone and DNA engagement", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:27926874", "year": 2016, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1016/j.celrep.2016.11.014" } ], "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4COS", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.celrep.2016.11.014", "kind": "publication", "kind_label": "Publication year", "date": "2016", "sort_date": "2016-00-00" }, { "id": "DOI:10.1016/j.jsb.2016.03.013", "reference_id": "PMID:26993463", "reference_ids": [ "PMID:26993463" ], "title": "Structural basis for recognition of histone H3K36me3 nucleosome by human de novo DNA methyltransferases 3A and 3B.", "authors": [ "Rondelet G", "Dal Maso T", "Willems L", "Wouters J" ], "year": 2016, "year_values": [ 2016 ], "year_conflict": false, "journal": "Journal of structural biology", "doi": "10.1016/j.jsb.2016.03.013", "pmid": 26993463, "url": "https://doi.org/10.1016/j.jsb.2016.03.013", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "DNMT3B PWWP-H3K36me3 crystal structures and nucleosome recognition", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:26993463", "year": 2016, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.jsb.2016.03.013" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5CIU", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.jsb.2016.03.013", "kind": "publication", "kind_label": "Publication year", "date": "2016", "sort_date": "2016-00-00" }, { "id": "DOI:10.1016/j.molcel.2016.06.035", "reference_id": "REF:PDB:5B73:primary", "reference_ids": [ "REF:PDB:5B73:primary" ], "title": "ZMYND8 Reads the Dual Histone Mark H3K4me1-H3K14ac to Antagonize the Expression of Metastasis-Linked Genes", "authors": [ "Li, N.", "Li, Y.", "Lv, J.", "Zheng, X.", "Wen, H.", "Shen, H.", "Zhu, G.", "Chen, T.Y.", "Dhar, S.S.", "Kan, P.Y.", "Wang, Z.", "Shiekhattar, R.", "Shi, X.", "Lan, F.", "Chen, K.", "Li, W.", "Li, H.", "Lee, M.G." ], "year": 2016, "year_values": [ 2016 ], "year_conflict": false, "journal": "Mol.Cell", "doi": "10.1016/j.molcel.2016.06.035", "pmid": 27477906, "url": "https://doi.org/10.1016/j.molcel.2016.06.035", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:5B73:primary", "year": 2016, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1016/j.molcel.2016.06.035" } ], "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5B73", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.molcel.2016.06.035", "kind": "publication", "kind_label": "Publication year", "date": "2016", "sort_date": "2016-00-00" }, { "id": "DOI:10.1074/jbc.m115.679985", "reference_id": "PMID:26655721", "reference_ids": [ "PMID:26655721" ], "title": "Selective Recognition of H3.1K36 Dimethylation/H4K16 Acetylation Facilitates the Regulation of All-trans-retinoic Acid (ATRA)-responsive Genes by Putative Chromatin Reader ZMYND8.", "authors": [ "Adhikary S", "Sanyal S", "Basu M", "Sengupta I", "Sen S", "Srivastava DK", "Roy S", "Das C" ], "year": 2016, "year_values": [ 2016 ], "year_conflict": false, "journal": "The Journal of biological chemistry", "doi": "10.1074/jbc.m115.679985", "pmid": 26655721, "url": "https://doi.org/10.1074/jbc.m115.679985", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Combinatorial histone recognition by ZMYND8", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:26655721", "year": 2016, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1074/jbc.m115.679985" } ], "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1074/jbc.m115.679985", "kind": "publication", "kind_label": "Publication year", "date": "2016", "sort_date": "2016-00-00" }, { "id": "DOI:10.1074/jbc.m116.720748", "reference_id": "PMID:26912663", "reference_ids": [ "PMID:26912663" ], "title": "A PWWP Domain of Histone-Lysine N-Methyltransferase NSD2 Binds to Dimethylated Lys-36 of Histone H3 and Regulates NSD2 Function at Chromatin.", "authors": [ "Sankaran SM", "Wilkinson AW", "Elias JE", "Gozani O" ], "year": 2016, "year_values": [ 2016 ], "year_conflict": false, "journal": "The Journal of biological chemistry", "doi": "10.1074/jbc.m116.720748", "pmid": 26912663, "url": "https://doi.org/10.1074/jbc.m116.720748", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "NSD2 PWWP recognition of H3K36me2 and chromatin recruitment", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:26912663", "year": 2016, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1074/jbc.m116.720748" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1074/jbc.m116.720748", "kind": "publication", "kind_label": "Publication year", "date": "2016", "sort_date": "2016-00-00" }, { "event_id": "PDB:2NAS:deposition", "id": "2NAS", "kind": "deposition", "kind_label": "PDB deposition", "date": "2016-01-10", "sort_date": "2016-01-10", "year": 2016, "title": "Solution structure of a PWWP doamin from Trypanosoma brucei", "url": "https://www.rcsb.org/structure/2NAS", "proteins": [ { "protein_id": "UP:Q586Y0", "uniprot": "Q586Y0", "gene": "28H13_90", "organism": "Trypanosoma brucei brucei (strain 927/4 GUTat10.1)" } ], "structures": [ { "pdb_id": "2NAS", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q586Y0:PWWP1", "gene": "28H13_90", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:2NAS:primary", "title": "Soluion Structure of a PWWP domain from Trypanosoma brucei", "url": "https://www.rcsb.org/structure/2NAS", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2016-01-10T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5CIU:release", "id": "5CIU", "kind": "release", "kind_label": "PDB initial release", "date": "2016-03-30", "sort_date": "2016-03-30", "year": 2016, "title": "Structural basis of the recognition of H3K36me3 by DNMT3B PWWP domain", "url": "https://www.rcsb.org/structure/5CIU", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5CIU", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.jsb.2016.03.013", "title": "Structural basis for recognition of histone H3K36me3 nucleosome by human de novo DNA methyltransferases 3A and 3B.", "url": "https://doi.org/10.1016/j.jsb.2016.03.013", "doi": "10.1016/j.jsb.2016.03.013", "pmid": 26993463, "year": 2016 } ], "date_precision": "day", "source_date": "2016-03-30T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5B73:deposition", "id": "5B73", "kind": "deposition", "kind_label": "PDB deposition", "date": "2016-06-03", "sort_date": "2016-06-03", "year": 2016, "title": "Crystal structure of human ZMYND8 PHD-Bromo-PWWP domain", "url": "https://www.rcsb.org/structure/5B73", "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5B73", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9ULU4:PWWP1", "gene": "ZMYND8", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2016.06.035", "title": "ZMYND8 Reads the Dual Histone Mark H3K4me1-H3K14ac to Antagonize the Expression of Metastasis-Linked Genes", "url": "https://doi.org/10.1016/j.molcel.2016.06.035", "doi": "10.1016/j.molcel.2016.06.035", "pmid": 27477906, "year": 2016 } ], "date_precision": "day", "source_date": "2016-06-03T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5B73:release", "id": "5B73", "kind": "release", "kind_label": "PDB initial release", "date": "2016-11-02", "sort_date": "2016-11-02", "year": 2016, "title": "Crystal structure of human ZMYND8 PHD-Bromo-PWWP domain", "url": "https://www.rcsb.org/structure/5B73", "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5B73", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9ULU4:PWWP1", "gene": "ZMYND8", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2016.06.035", "title": "ZMYND8 Reads the Dual Histone Mark H3K4me1-H3K14ac to Antagonize the Expression of Metastasis-Linked Genes", "url": "https://doi.org/10.1016/j.molcel.2016.06.035", "doi": "10.1016/j.molcel.2016.06.035", "pmid": 27477906, "year": 2016 } ], "date_precision": "day", "source_date": "2016-11-02T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1016/j.str.2017.08.014", "reference_id": "PMID:28966017", "reference_ids": [ "PMID:28966017" ], "title": "The Structure of the ZMYND8/Drebrin Complex Suggests a Cytoplasmic Sequestering Mechanism of ZMYND8 by Drebrin.", "authors": [ "Yao N", "Li J", "Liu H", "Wan J", "Liu W", "Zhang M" ], "year": 2017, "year_values": [ 2017 ], "year_conflict": false, "journal": "Structure (London, England : 1993)", "doi": "10.1016/j.str.2017.08.014", "pmid": 28966017, "url": "https://doi.org/10.1016/j.str.2017.08.014", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "ZMYND8-drebrin structural interaction", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:28966017", "year": 2017, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.str.2017.08.014" } ], "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5Y1Z", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.str.2017.08.014", "kind": "publication", "kind_label": "Publication year", "date": "2017", "sort_date": "2017-00-00" }, { "id": "DOI:10.15252/embj.201695757", "reference_id": "PMID:28645917", "reference_ids": [ "PMID:28645917" ], "title": "Multivalent binding of PWWP2A to H2A.Z regulates mitosis and neural crest differentiation.", "authors": [ "Pünzeler S", "Link S", "Wagner G", "Keilhauer EC", "Kronbeck N", "Spitzer RM", "Leidescher S", "Markaki Y", "Mentele E", "Regnard C", "Schneider K", "Takahashi D", "Kusakabe M", "Vardabasso C", "Zink LM", "Straub T", "Bernstein E", "Harata M", "Leonhardt H", "Mann M", "Rupp RA", "Hake SB" ], "year": 2017, "year_values": [ 2017 ], "year_conflict": false, "journal": "The EMBO journal", "doi": "10.15252/embj.201695757", "pmid": 28645917, "url": "https://doi.org/10.15252/embj.201695757", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP2A multivalent H2A.Z nucleosome binding", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:28645917", "year": 2017, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.15252/embj.201695757" } ], "proteins": [ { "protein_id": "UP:Q96N64", "uniprot": "Q96N64", "gene": "PWWP2A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.15252/embj.201695757", "kind": "publication", "kind_label": "Publication year", "date": "2017", "sort_date": "2017-00-00" }, { "event_id": "PDB:2NAS:release", "id": "2NAS", "kind": "release", "kind_label": "PDB initial release", "date": "2017-01-18", "sort_date": "2017-01-18", "year": 2017, "title": "Solution structure of a PWWP doamin from Trypanosoma brucei", "url": "https://www.rcsb.org/structure/2NAS", "proteins": [ { "protein_id": "UP:Q586Y0", "uniprot": "Q586Y0", "gene": "28H13_90", "organism": "Trypanosoma brucei brucei (strain 927/4 GUTat10.1)" } ], "structures": [ { "pdb_id": "2NAS", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q586Y0:PWWP1", "gene": "28H13_90", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:2NAS:primary", "title": "Soluion Structure of a PWWP domain from Trypanosoma brucei", "url": "https://www.rcsb.org/structure/2NAS", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2017-01-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5VC8:deposition", "id": "5VC8", "kind": "deposition", "kind_label": "PDB deposition", "date": "2017-03-31", "sort_date": "2017-03-31", "year": 2017, "title": "Crystal structure of the WHSC1 PWWP1 domain", "url": "https://www.rcsb.org/structure/5VC8", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5VC8", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.bbrc.2021.07.017", "title": "Histone and DNA binding ability studies of the NSD subfamily of PWWP domains.", "url": "https://doi.org/10.1016/j.bbrc.2021.07.017", "doi": "10.1016/j.bbrc.2021.07.017", "pmid": 34271259, "year": 2021 } ], "date_precision": "day", "source_date": "2017-03-31T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5NR3:deposition", "id": "5NR3", "kind": "deposition", "kind_label": "PDB deposition", "date": "2017-04-21", "sort_date": "2017-04-21", "year": 2017, "title": "Human DNMT3B PWWP domain in complex with ethambutol", "url": "https://www.rcsb.org/structure/5NR3", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NR3", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:5NR3:primary", "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "url": "https://www.rcsb.org/structure/5NR3", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2017-04-21T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5NRR:deposition", "id": "5NRR", "kind": "deposition", "kind_label": "PDB deposition", "date": "2017-04-25", "sort_date": "2017-04-25", "year": 2017, "title": "Human DNMT3B PWWP domain in complex with 5-[(2-Hydroxyethyl)(propyl)amino]-1-pentanol", "url": "https://www.rcsb.org/structure/5NRR", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NRR", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:5NRR:primary", "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "url": "https://www.rcsb.org/structure/5NRR", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2017-04-25T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5NRS:deposition", "id": "5NRS", "kind": "deposition", "kind_label": "PDB deposition", "date": "2017-04-25", "sort_date": "2017-04-25", "year": 2017, "title": "Human DNMT3B PWWP domain in complex with N,N-bis(2-hydroxypropyl)ethanolamine", "url": "https://www.rcsb.org/structure/5NRS", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NRS", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:5NRS:primary", "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "url": "https://www.rcsb.org/structure/5NRS", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2017-04-25T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5NRV:deposition", "id": "5NRV", "kind": "deposition", "kind_label": "PDB deposition", "date": "2017-04-25", "sort_date": "2017-04-25", "year": 2017, "title": "Human DNMT3B PWWP domain in complex with 6-dipropylamino-1-hexanol", "url": "https://www.rcsb.org/structure/5NRV", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NRV", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:5NRV:primary", "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "url": "https://www.rcsb.org/structure/5NRV", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2017-04-25T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5NV0:deposition", "id": "5NV0", "kind": "deposition", "kind_label": "PDB deposition", "date": "2017-05-03", "sort_date": "2017-05-03", "year": 2017, "title": "Human DNMT3B PWWP domain in complex with 4-(dipropylamino)butyronitrile", "url": "https://www.rcsb.org/structure/5NV0", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NV0", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:5NV0:primary", "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "url": "https://www.rcsb.org/structure/5NV0", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2017-05-03T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5NV2:deposition", "id": "5NV2", "kind": "deposition", "kind_label": "PDB deposition", "date": "2017-05-03", "sort_date": "2017-05-03", "year": 2017, "title": "Human DNMT3B PWWP domain in complex with N-isopropyl-1,5-dimethylhexylamine (Metron S)", "url": "https://www.rcsb.org/structure/5NV2", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NV2", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:5NV2:primary", "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "url": "https://www.rcsb.org/structure/5NV2", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2017-05-03T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5NV7:deposition", "id": "5NV7", "kind": "deposition", "kind_label": "PDB deposition", "date": "2017-05-03", "sort_date": "2017-05-03", "year": 2017, "title": "Human DNMT3B PWWP domain in complex with N1-(2-hydroxyethyl)-2-methyl-1,2-propanediamine", "url": "https://www.rcsb.org/structure/5NV7", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NV7", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:5NV7:primary", "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "url": "https://www.rcsb.org/structure/5NV7", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2017-05-03T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5NVO:deposition", "id": "5NVO", "kind": "deposition", "kind_label": "PDB deposition", "date": "2017-05-04", "sort_date": "2017-05-04", "year": 2017, "title": "Human DNMT3B PWWP domain in complex with choline", "url": "https://www.rcsb.org/structure/5NVO", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NVO", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:5NVO:primary", "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "url": "https://www.rcsb.org/structure/5NVO", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2017-05-04T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5XSK:deposition", "id": "5XSK", "kind": "deposition", "kind_label": "PDB deposition", "date": "2017-06-14", "sort_date": "2017-06-14", "year": 2017, "title": "Crystal structure of PWWP-DNA complex for human hepatoma-derived growth factor", "url": "https://www.rcsb.org/structure/5XSK", "proteins": [ { "protein_id": "UP:Q8VHK7", "uniprot": "Q8VHK7", "gene": "Hdgf", "organism": "Rattus norvegicus" } ], "structures": [ { "pdb_id": "5XSK", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q8VHK7:PWWP1", "gene": "Hdgf", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41598-017-18510-8", "title": "Domain swapping and SMYD1 interactions with the PWWP domain of human hepatoma-derived growth factor.", "url": "https://doi.org/10.1038/s41598-017-18510-8", "doi": "10.1038/s41598-017-18510-8", "pmid": 29321480, "year": 2018 }, { "id": "REF:PDB:5XSK:primary", "title": "Structure of PWWP-DNA complex at 2.84 Angstroms resolution", "url": "https://www.rcsb.org/structure/5XSK", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2017-06-14T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5XSL:deposition", "id": "5XSL", "kind": "deposition", "kind_label": "PDB deposition", "date": "2017-06-14", "sort_date": "2017-06-14", "year": 2017, "title": "Crystal structure of the PWWP domain of human hepatoma-derived growth factor", "url": "https://www.rcsb.org/structure/5XSL", "proteins": [ { "protein_id": "UP:Q8VHK7", "uniprot": "Q8VHK7", "gene": "Hdgf", "organism": "Rattus norvegicus" } ], "structures": [ { "pdb_id": "5XSL", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q8VHK7:PWWP1", "gene": "Hdgf", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41598-017-18510-8", "title": "Domain swapping and SMYD1 interactions with the PWWP domain of human hepatoma-derived growth factor.", "url": "https://doi.org/10.1038/s41598-017-18510-8", "doi": "10.1038/s41598-017-18510-8", "pmid": 29321480, "year": 2018 }, { "id": "REF:PDB:5XSL:primary", "title": "Structure of the PWWP domain at 3.3 Angstroms resolution", "url": "https://www.rcsb.org/structure/5XSL", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2017-06-14T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5VC8:release", "id": "5VC8", "kind": "release", "kind_label": "PDB initial release", "date": "2017-06-28", "sort_date": "2017-06-28", "year": 2017, "title": "Crystal structure of the WHSC1 PWWP1 domain", "url": "https://www.rcsb.org/structure/5VC8", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5VC8", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.bbrc.2021.07.017", "title": "Histone and DNA binding ability studies of the NSD subfamily of PWWP domains.", "url": "https://doi.org/10.1016/j.bbrc.2021.07.017", "doi": "10.1016/j.bbrc.2021.07.017", "pmid": 34271259, "year": 2021 } ], "date_precision": "day", "source_date": "2017-06-28T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5Y1Z:deposition", "id": "5Y1Z", "kind": "deposition", "kind_label": "PDB deposition", "date": "2017-07-22", "sort_date": "2017-07-22", "year": 2017, "title": "Crystal structure of ZMYND8 PHD-BROMO-PWWP tandem in complex with Drebrin ADF-H domain", "url": "https://www.rcsb.org/structure/5Y1Z", "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5Y1Z", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9ULU4:PWWP1", "gene": "ZMYND8", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.str.2017.08.014", "title": "The Structure of the ZMYND8/Drebrin Complex Suggests a Cytoplasmic Sequestering Mechanism of ZMYND8 by Drebrin.", "url": "https://doi.org/10.1016/j.str.2017.08.014", "doi": "10.1016/j.str.2017.08.014", "pmid": 28966017, "year": 2017 } ], "date_precision": "day", "source_date": "2017-07-22T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5Y1Z:release", "id": "5Y1Z", "kind": "release", "kind_label": "PDB initial release", "date": "2017-10-25", "sort_date": "2017-10-25", "year": 2017, "title": "Crystal structure of ZMYND8 PHD-BROMO-PWWP tandem in complex with Drebrin ADF-H domain", "url": "https://www.rcsb.org/structure/5Y1Z", "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5Y1Z", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9ULU4:PWWP1", "gene": "ZMYND8", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.str.2017.08.014", "title": "The Structure of the ZMYND8/Drebrin Complex Suggests a Cytoplasmic Sequestering Mechanism of ZMYND8 by Drebrin.", "url": "https://doi.org/10.1016/j.str.2017.08.014", "doi": "10.1016/j.str.2017.08.014", "pmid": 28966017, "year": 2017 } ], "date_precision": "day", "source_date": "2017-10-25T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1038/s41467-018-06235-9", "reference_id": "PMID:30228260", "reference_ids": [ "PMID:30228260" ], "title": "A variant NuRD complex containing PWWP2A/B excludes MBD2/3 to regulate transcription at active genes.", "authors": [ "Zhang T", "Wei G", "Millard CJ", "Fischer R", "Konietzny R", "Kessler BM", "Schwabe JWR", "Brockdorff N" ], "year": 2018, "year_values": [ 2018 ], "year_conflict": false, "journal": "Nature communications", "doi": "10.1038/s41467-018-06235-9", "pmid": 30228260, "url": "https://doi.org/10.1038/s41467-018-06235-9", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP2A/B variant NuRD complexes at active genes", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "source_records": [ { "reference_id": "PMID:30228260", "year": 2018, "source_type": "primary_experimental_research", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "url": "https://doi.org/10.1038/s41467-018-06235-9" } ], "proteins": [ { "protein_id": "UP:Q6NUJ5", "uniprot": "Q6NUJ5", "gene": "PWWP2B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q96N64", "uniprot": "Q96N64", "gene": "PWWP2A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/s41467-018-06235-9", "kind": "publication", "kind_label": "Publication year", "date": "2018", "sort_date": "2018-00-00" }, { "id": "DOI:10.1038/s41467-018-06665-5", "reference_id": "PMID:30327463", "reference_ids": [ "PMID:30327463" ], "title": "PWWP2A binds distinct chromatin moieties and interacts with an MTA1-specific core NuRD complex.", "authors": [ "Link S", "Spitzer RMM", "Sana M", "Torrado M", "Völker-Albert MC", "Keilhauer EC", "Burgold T", "Pünzeler S", "Low JKK", "Lindström I", "Nist A", "Regnard C", "Stiewe T", "Hendrich B", "Imhof A", "Mann M", "Mackay JP", "Bartkuhn M", "Hake SB" ], "year": 2018, "year_values": [ 2018 ], "year_conflict": false, "journal": "Nature communications", "doi": "10.1038/s41467-018-06665-5", "pmid": 30327463, "url": "https://doi.org/10.1038/s41467-018-06665-5", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP2A chromatin contacts and MTA1-specific NuRD; modeled PWWP structure is not experimental", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:30327463", "year": 2018, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1038/s41467-018-06665-5" } ], "proteins": [ { "protein_id": "UP:Q96N64", "uniprot": "Q96N64", "gene": "PWWP2A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/s41467-018-06665-5", "kind": "publication", "kind_label": "Publication year", "date": "2018", "sort_date": "2018-00-00" }, { "id": "DOI:10.1038/s41598-017-18510-8", "reference_id": "PMID:29321480", "reference_ids": [ "PMID:29321480" ], "title": "Domain swapping and SMYD1 interactions with the PWWP domain of human hepatoma-derived growth factor.", "authors": [ "Chen LY", "Huang YC", "Huang ST", "Hsieh YC", "Guan HH", "Chen NC", "Chuankhayan P", "Yoshimura M", "Tai MH", "Chen CJ" ], "year": 2018, "year_values": [ 2018 ], "year_conflict": false, "journal": "Scientific reports", "doi": "10.1038/s41598-017-18510-8", "pmid": 29321480, "url": "https://doi.org/10.1038/s41598-017-18510-8", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "HDGF domain swapping and SMYD1 interaction", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:29321480", "year": 2018, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1038/s41598-017-18510-8" } ], "proteins": [ { "protein_id": "UP:P51858", "uniprot": "P51858", "gene": "HDGF", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5XSK", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "5XSL", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/s41598-017-18510-8", "kind": "publication", "kind_label": "Publication year", "date": "2018", "sort_date": "2018-00-00" }, { "event_id": "PDB:6G24:deposition", "id": "6G24", "kind": "deposition", "kind_label": "PDB deposition", "date": "2018-03-22", "sort_date": "2018-03-22", "year": 2018, "title": "X-ray structure of NSD3-PWWP1 in complex with compound 3", "url": "https://www.rcsb.org/structure/6G24", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G24", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2018-03-22T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G25:deposition", "id": "6G25", "kind": "deposition", "kind_label": "PDB deposition", "date": "2018-03-22", "sort_date": "2018-03-22", "year": 2018, "title": "X-ray structure of NSD3-PWWP1 in complex with compound 4", "url": "https://www.rcsb.org/structure/6G25", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G25", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2018-03-22T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G27:deposition", "id": "6G27", "kind": "deposition", "kind_label": "PDB deposition", "date": "2018-03-22", "sort_date": "2018-03-22", "year": 2018, "title": "X-ray structure of NSD3-PWWP1 in complex with compound 5", "url": "https://www.rcsb.org/structure/6G27", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G27", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2018-03-22T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G29:deposition", "id": "6G29", "kind": "deposition", "kind_label": "PDB deposition", "date": "2018-03-22", "sort_date": "2018-03-22", "year": 2018, "title": "X-ray structure of NSD3-PWWP1 in complex with compound 6", "url": "https://www.rcsb.org/structure/6G29", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G29", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2018-03-22T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G2B:deposition", "id": "6G2B", "kind": "deposition", "kind_label": "PDB deposition", "date": "2018-03-22", "sort_date": "2018-03-22", "year": 2018, "title": "X-ray structure of NSD3-PWWP1 in complex with compound 8", "url": "https://www.rcsb.org/structure/6G2B", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G2B", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2018-03-22T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G2C:deposition", "id": "6G2C", "kind": "deposition", "kind_label": "PDB deposition", "date": "2018-03-22", "sort_date": "2018-03-22", "year": 2018, "title": "X-ray structure of NSD3-PWWP1 in complex with compound 9", "url": "https://www.rcsb.org/structure/6G2C", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G2C", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2018-03-22T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G2E:deposition", "id": "6G2E", "kind": "deposition", "kind_label": "PDB deposition", "date": "2018-03-23", "sort_date": "2018-03-23", "year": 2018, "title": "X-ray structure of NSD3-PWWP1 in complex with compound 13", "url": "https://www.rcsb.org/structure/6G2E", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G2E", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2018-03-23T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G2F:deposition", "id": "6G2F", "kind": "deposition", "kind_label": "PDB deposition", "date": "2018-03-23", "sort_date": "2018-03-23", "year": 2018, "title": "X-ray structure of NSD3-PWWP1 in complex with compound 16", "url": "https://www.rcsb.org/structure/6G2F", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G2F", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2018-03-23T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G2O:deposition", "id": "6G2O", "kind": "deposition", "kind_label": "PDB deposition", "date": "2018-03-23", "sort_date": "2018-03-23", "year": 2018, "title": "X-ray structure of NSD3-PWWP1 in complex with compound BI-9321", "url": "https://www.rcsb.org/structure/6G2O", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G2O", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2018-03-23T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G3P:deposition", "id": "6G3P", "kind": "deposition", "kind_label": "PDB deposition", "date": "2018-03-26", "sort_date": "2018-03-26", "year": 2018, "title": "X-ray structure of seleno-methionine labelled NSD3-PWWP1", "url": "https://www.rcsb.org/structure/6G3P", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G3P", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2018-03-26T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G3T:deposition", "id": "6G3T", "kind": "deposition", "kind_label": "PDB deposition", "date": "2018-03-26", "sort_date": "2018-03-26", "year": 2018, "title": "X-ray structure of NSD3-PWWP1", "url": "https://www.rcsb.org/structure/6G3T", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G3T", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2018-03-26T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5NR3:release", "id": "5NR3", "kind": "release", "kind_label": "PDB initial release", "date": "2018-05-30", "sort_date": "2018-05-30", "year": 2018, "title": "Human DNMT3B PWWP domain in complex with ethambutol", "url": "https://www.rcsb.org/structure/5NR3", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NR3", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:5NR3:primary", "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "url": "https://www.rcsb.org/structure/5NR3", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2018-05-30T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5NRR:release", "id": "5NRR", "kind": "release", "kind_label": "PDB initial release", "date": "2018-05-30", "sort_date": "2018-05-30", "year": 2018, "title": "Human DNMT3B PWWP domain in complex with 5-[(2-Hydroxyethyl)(propyl)amino]-1-pentanol", "url": "https://www.rcsb.org/structure/5NRR", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NRR", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:5NRR:primary", "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "url": "https://www.rcsb.org/structure/5NRR", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2018-05-30T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5NRS:release", "id": "5NRS", "kind": "release", "kind_label": "PDB initial release", "date": "2018-05-30", "sort_date": "2018-05-30", "year": 2018, "title": "Human DNMT3B PWWP domain in complex with N,N-bis(2-hydroxypropyl)ethanolamine", "url": "https://www.rcsb.org/structure/5NRS", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NRS", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:5NRS:primary", "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "url": "https://www.rcsb.org/structure/5NRS", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2018-05-30T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5NV0:release", "id": "5NV0", "kind": "release", "kind_label": "PDB initial release", "date": "2018-05-30", "sort_date": "2018-05-30", "year": 2018, "title": "Human DNMT3B PWWP domain in complex with 4-(dipropylamino)butyronitrile", "url": "https://www.rcsb.org/structure/5NV0", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NV0", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:5NV0:primary", "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "url": "https://www.rcsb.org/structure/5NV0", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2018-05-30T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5NV2:release", "id": "5NV2", "kind": "release", "kind_label": "PDB initial release", "date": "2018-05-30", "sort_date": "2018-05-30", "year": 2018, "title": "Human DNMT3B PWWP domain in complex with N-isopropyl-1,5-dimethylhexylamine (Metron S)", "url": "https://www.rcsb.org/structure/5NV2", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NV2", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:5NV2:primary", "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "url": "https://www.rcsb.org/structure/5NV2", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2018-05-30T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5NV7:release", "id": "5NV7", "kind": "release", "kind_label": "PDB initial release", "date": "2018-05-30", "sort_date": "2018-05-30", "year": 2018, "title": "Human DNMT3B PWWP domain in complex with N1-(2-hydroxyethyl)-2-methyl-1,2-propanediamine", "url": "https://www.rcsb.org/structure/5NV7", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NV7", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:5NV7:primary", "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "url": "https://www.rcsb.org/structure/5NV7", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2018-05-30T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5NVO:release", "id": "5NVO", "kind": "release", "kind_label": "PDB initial release", "date": "2018-05-30", "sort_date": "2018-05-30", "year": 2018, "title": "Human DNMT3B PWWP domain in complex with choline", "url": "https://www.rcsb.org/structure/5NVO", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NVO", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:5NVO:primary", "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "url": "https://www.rcsb.org/structure/5NVO", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2018-05-30T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5NRV:release", "id": "5NRV", "kind": "release", "kind_label": "PDB initial release", "date": "2018-06-13", "sort_date": "2018-06-13", "year": 2018, "title": "Human DNMT3B PWWP domain in complex with 6-dipropylamino-1-hexanol", "url": "https://www.rcsb.org/structure/5NRV", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "5NRV", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:5NRV:primary", "title": "Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors", "url": "https://www.rcsb.org/structure/5NRV", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2018-06-13T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5XSK:release", "id": "5XSK", "kind": "release", "kind_label": "PDB initial release", "date": "2018-06-20", "sort_date": "2018-06-20", "year": 2018, "title": "Crystal structure of PWWP-DNA complex for human hepatoma-derived growth factor", "url": "https://www.rcsb.org/structure/5XSK", "proteins": [ { "protein_id": "UP:Q8VHK7", "uniprot": "Q8VHK7", "gene": "Hdgf", "organism": "Rattus norvegicus" } ], "structures": [ { "pdb_id": "5XSK", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q8VHK7:PWWP1", "gene": "Hdgf", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41598-017-18510-8", "title": "Domain swapping and SMYD1 interactions with the PWWP domain of human hepatoma-derived growth factor.", "url": "https://doi.org/10.1038/s41598-017-18510-8", "doi": "10.1038/s41598-017-18510-8", "pmid": 29321480, "year": 2018 }, { "id": "REF:PDB:5XSK:primary", "title": "Structure of PWWP-DNA complex at 2.84 Angstroms resolution", "url": "https://www.rcsb.org/structure/5XSK", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2018-06-20T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:5XSL:release", "id": "5XSL", "kind": "release", "kind_label": "PDB initial release", "date": "2018-06-20", "sort_date": "2018-06-20", "year": 2018, "title": "Crystal structure of the PWWP domain of human hepatoma-derived growth factor", "url": "https://www.rcsb.org/structure/5XSL", "proteins": [ { "protein_id": "UP:Q8VHK7", "uniprot": "Q8VHK7", "gene": "Hdgf", "organism": "Rattus norvegicus" } ], "structures": [ { "pdb_id": "5XSL", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q8VHK7:PWWP1", "gene": "Hdgf", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41598-017-18510-8", "title": "Domain swapping and SMYD1 interactions with the PWWP domain of human hepatoma-derived growth factor.", "url": "https://doi.org/10.1038/s41598-017-18510-8", "doi": "10.1038/s41598-017-18510-8", "pmid": 29321480, "year": 2018 }, { "id": "REF:PDB:5XSL:primary", "title": "Structure of the PWWP domain at 3.3 Angstroms resolution", "url": "https://www.rcsb.org/structure/5XSL", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2018-06-20T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6IIP:deposition", "id": "6IIP", "kind": "deposition", "kind_label": "PDB deposition", "date": "2018-10-07", "sort_date": "2018-10-07", "year": 2018, "title": "Apo-form structure of the HRP3 PWWP domain", "url": "https://www.rcsb.org/structure/6IIP", "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIP", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y3E1:PWWP1", "gene": "HDGFL3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkz294", "title": "The HRP3 PWWP domain recognizes the minor groove of double-stranded DNA and recruits HRP3 to chromatin.", "url": "https://doi.org/10.1093/nar/gkz294", "doi": "10.1093/nar/gkz294", "pmid": 31162607, "year": 2019 }, { "id": "REF:PDB:6IIP:primary", "title": "Apo-form structure of the HRP3 PWWP domain", "url": "https://www.rcsb.org/structure/6IIP", "doi": null, "pmid": null, "year": 2019 } ], "date_precision": "day", "source_date": "2018-10-07T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6IIQ:deposition", "id": "6IIQ", "kind": "deposition", "kind_label": "PDB deposition", "date": "2018-10-07", "sort_date": "2018-10-07", "year": 2018, "title": "Complex structure of the HRP3 PWWP domain with a 16-bp TA-rich DNA", "url": "https://www.rcsb.org/structure/6IIQ", "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIQ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y3E1:PWWP1", "gene": "HDGFL3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkz294", "title": "The HRP3 PWWP domain recognizes the minor groove of double-stranded DNA and recruits HRP3 to chromatin.", "url": "https://doi.org/10.1093/nar/gkz294", "doi": "10.1093/nar/gkz294", "pmid": 31162607, "year": 2019 }, { "id": "REF:PDB:6IIQ:primary", "title": "Complex structure of the HRP3 PWWP domain with a 16-bp TA-rich DNA", "url": "https://www.rcsb.org/structure/6IIQ", "doi": null, "pmid": null, "year": 2019 } ], "date_precision": "day", "source_date": "2018-10-07T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6IIR:deposition", "id": "6IIR", "kind": "deposition", "kind_label": "PDB deposition", "date": "2018-10-07", "sort_date": "2018-10-07", "year": 2018, "title": "Complex structure of the HRP3 PWWP domain with a 10-bp GC-rich DNA", "url": "https://www.rcsb.org/structure/6IIR", "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIR", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y3E1:PWWP1", "gene": "HDGFL3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkz294", "title": "The HRP3 PWWP domain recognizes the minor groove of double-stranded DNA and recruits HRP3 to chromatin.", "url": "https://doi.org/10.1093/nar/gkz294", "doi": "10.1093/nar/gkz294", "pmid": 31162607, "year": 2019 }, { "id": "REF:PDB:6IIR:primary", "title": "Complex structure of the HRP3 PWWP domain with a 10-bp GC-rich DNA", "url": "https://www.rcsb.org/structure/6IIR", "doi": null, "pmid": null, "year": 2019 } ], "date_precision": "day", "source_date": "2018-10-07T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6IIS:deposition", "id": "6IIS", "kind": "deposition", "kind_label": "PDB deposition", "date": "2018-10-07", "sort_date": "2018-10-07", "year": 2018, "title": "Complex structure of the HRP3 PWWP domain with both a 16-bp TA-rich DNA and an H3K36me3-containing histone peptide", "url": "https://www.rcsb.org/structure/6IIS", "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIS", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y3E1:PWWP1", "gene": "HDGFL3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkz294", "title": "The HRP3 PWWP domain recognizes the minor groove of double-stranded DNA and recruits HRP3 to chromatin.", "url": "https://doi.org/10.1093/nar/gkz294", "doi": "10.1093/nar/gkz294", "pmid": 31162607, "year": 2019 }, { "id": "REF:PDB:6IIS:primary", "title": "Complex structure of the HRP3 PWWP domain with both a 16-bp TA-rich DNA and an H3K36me3-containing histone peptide", "url": "https://www.rcsb.org/structure/6IIS", "doi": null, "pmid": null, "year": 2019 } ], "date_precision": "day", "source_date": "2018-10-07T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6IIT:deposition", "id": "6IIT", "kind": "deposition", "kind_label": "PDB deposition", "date": "2018-10-07", "sort_date": "2018-10-07", "year": 2018, "title": "Complex structure of the HRP3 PWWP domain with both a 16-bp TA-rich DNA and an H3K36me2-containing histone peptide", "url": "https://www.rcsb.org/structure/6IIT", "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIT", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y3E1:PWWP1", "gene": "HDGFL3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkz294", "title": "The HRP3 PWWP domain recognizes the minor groove of double-stranded DNA and recruits HRP3 to chromatin.", "url": "https://doi.org/10.1093/nar/gkz294", "doi": "10.1093/nar/gkz294", "pmid": 31162607, "year": 2019 }, { "id": "REF:PDB:6IIT:primary", "title": "Complex structure of the HRP3 PWWP domain with both a 16-bp TA-rich DNA and a H3K36me2-containing histone peptide", "url": "https://www.rcsb.org/structure/6IIT", "doi": null, "pmid": null, "year": 2019 } ], "date_precision": "day", "source_date": "2018-10-07T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1007/s12104-019-09873-2", "reference_id": "PMID:30666492", "reference_ids": [ "PMID:30666492" ], "title": "Resonance assignments for the tandem PWWP-ARID domains of human RBBP1.", "authors": [ "Gong W", "Yao X", "Liang Q", "Tong Y", "Perrett S", "Feng Y" ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Biomolecular NMR assignments", "doi": "10.1007/s12104-019-09873-2", "pmid": 30666492, "url": "https://doi.org/10.1007/s12104-019-09873-2", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "NMR resonance assignments of human RBBP1 tandem PWWP-ARID; assignment report distinguished from structure determination", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:30666492", "year": 2019, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1007/s12104-019-09873-2" } ], "proteins": [ { "protein_id": "UP:P29374", "uniprot": "P29374", "gene": "ARID4A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1007/s12104-019-09873-2", "kind": "publication", "kind_label": "Publication year", "date": "2019", "sort_date": "2019-00-00" }, { "id": "DOI:10.1016/j.jmb.2019.09.006", "reference_id": "PMID:31634469", "reference_ids": [ "PMID:31634469" ], "title": "H3K36me2/3 Binding and DNA Binding of the DNA Methyltransferase DNMT3A PWWP Domain Both Contribute to its Chromatin Interaction.", "authors": [ "Dukatz M", "Holzer K", "Choudalakis M", "Emperle M", "Lungu C", "Bashtrykov P", "Jeltsch A" ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Journal of molecular biology", "doi": "10.1016/j.jmb.2019.09.006", "pmid": 31634469, "url": "https://doi.org/10.1016/j.jmb.2019.09.006", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "DNA and H3K36me2/3 contributions to DNMT3A PWWP chromatin interaction", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:31634469", "year": 2019, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.jmb.2019.09.006" } ], "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.jmb.2019.09.006", "kind": "publication", "kind_label": "Publication year", "date": "2019", "sort_date": "2019-00-00" }, { "id": "DOI:10.1038/s41589-019-0310-x", "reference_id": "PMID:31285596", "reference_ids": [ "PMID:31285596" ], "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "authors": [ "Böttcher J", "Dilworth D", "Reiser U", "Neumüller RA", "Schleicher M", "Petronczki M", "Zeeb M", "Mischerikow N", "Allali-Hassani A", "Szewczyk MM", "Li F", "Kennedy S", "Vedadi M", "Barsyte-Lovejoy D", "Brown PJ", "Huber KVM", "Rogers CM", "Wells CI", "Fedorov O", "Rumpel K", "Zoephel A", "Mayer M", "Wunberg T", "Böse D", "Zahn S", "Arnhof H", "Berger H", "Reiser C", "Hörmann A", "Krammer T", "Corcokovic M", "Sharps B", "Winkler S", "Häring D", "Cockcroft XL", "Fuchs JE", "Müllauer B", "Weiss-Puxbaum A", "Gerstberger T", "Boehmelt G", "Vakoc CR", "Arrowsmith CH", "Pearson M", "McConnell DB" ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Nature chemical biology", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "url": "https://doi.org/10.1038/s41589-019-0310-x", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "BI-9321 PWWP1 chemical probe and fragment-to-probe development", "verification_level": "primary_data_availability_and_developer_assays_verified", "source_records": [ { "reference_id": "PMID:31285596", "year": 2019, "source_type": "primary_experimental_research", "verification_level": "primary_data_availability_and_developer_assays_verified", "url": "https://doi.org/10.1038/s41589-019-0310-x" } ], "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G24", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G25", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G27", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G29", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G2B", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G2C", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G2E", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G2F", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G2O", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G3P", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6G3T", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [ { "name": "BI-9321", "preparation_id": "PREP:BI-9321", "chemical_identity_status": "exact_single_CCD_identity", "assay_ids": [ "PWWP:ASSAY:0008", "PWWP:ASSAY:0009" ], "evidence_classes": [ "cellular_interaction_response", "direct_binding_affinity" ], "domain_ids": [ "UP:Q9BZ95:PWWP1" ] } ], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/s41589-019-0310-x", "kind": "publication", "kind_label": "Publication year", "date": "2019", "sort_date": "2019-00-00" }, { "id": "DOI:10.1042/bcj20180870", "reference_id": "PMID:30626613", "reference_ids": [ "PMID:30626613" ], "title": "Solution structure of TbTFIIS2-2 PWWP domain from Trypanosoma brucei and its binding to H4K17me3 and H3K32me3.", "authors": [ "Wang R", "Gao J", "Zhang J", "Zhang X", "Xu C", "Liao S", "Tu X" ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "The Biochemical journal", "doi": "10.1042/bcj20180870", "pmid": 30626613, "url": "https://doi.org/10.1042/bcj20180870", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Trypanosoma PWWP solution structure and methylhistone binding", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:30626613", "year": 2019, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1042/bcj20180870" } ], "proteins": [], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1042/bcj20180870", "kind": "publication", "kind_label": "Publication year", "date": "2019", "sort_date": "2019-00-00" }, { "id": "DOI:10.1093/nar/gkz294", "reference_id": "PMID:31162607", "reference_ids": [ "PMID:31162607" ], "title": "The HRP3 PWWP domain recognizes the minor groove of double-stranded DNA and recruits HRP3 to chromatin.", "authors": [ "Tian W", "Yan P", "Xu N", "Chakravorty A", "Liefke R", "Xi Q", "Wang Z" ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Nucleic acids research", "doi": "10.1093/nar/gkz294", "pmid": 31162607, "url": "https://doi.org/10.1093/nar/gkz294", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "HRP3 PWWP recognition of DNA minor groove", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:31162607", "year": 2019, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1093/nar/gkz294" } ], "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIP", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6IIQ", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6IIR", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6IIS", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6IIT", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1093/nar/gkz294", "kind": "publication", "kind_label": "Publication year", "date": "2019", "sort_date": "2019-00-00" }, { "id": "DOI:10.1107/s2059798319011471", "reference_id": "REF:PDB:29HG:1", "reference_ids": [ "REF:PDB:29HG:1" ], "title": "Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix", "authors": [ "Liebschner, D.", "Afonine, P.V.", "Baker, M.L.", "Bunkoczi, G.", "Chen, V.B.", "Croll, T.I.", "Hintze, B.", "Hung, L.W.", "Jain, S.", "McCoy, A.J.", "Moriarty, N.W.", "Oeffner, R.D.", "Poon, B.K.", "Prisant, M.G.", "Read, R.J.", "Richardson, J.S.", "Richardson, D.C.", "Sammito, M.D.", "Sobolev, O.V.", "Stockwell, D.H.", "Terwilliger, T.C.", "Urzhumtsev, A.G.", "Videau, L.L.", "Williams, C.J.", "Adams, P.D." ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Acta Crystallogr., Sect. D: Biol. Crystallogr.", "doi": "10.1107/S2059798319011471", "pmid": 31588918, "url": "https://doi.org/10.1107/S2059798319011471", "source_type": "experimental_deposition_bibliography", "citation_role": "methodological_context", "citation_role_label": "Methodological citation · not a PWWP finding", "citation_role_basis": "The recorded title identifies Phenix structure-determination methodology; REF:PDB:29HG:1 is a supporting deposition citation, not its primary PWWP article.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:29HG:1", "year": 2019, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1107/S2059798319011471" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "29HG", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "29HH", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "29HI", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1107/s2059798319011471", "kind": "publication", "kind_label": "Publication year · methods context", "date": "2019", "sort_date": "2019-00-00" }, { "id": "DOI:10.1126/sciadv.aay3068", "reference_id": "PMID:31616795", "reference_ids": [ "PMID:31616795" ], "title": "LEDGF and HDGF2 relieve the nucleosome-induced barrier to transcription in differentiated cells.", "authors": [ "LeRoy G", "Oksuz O", "Descostes N", "Aoi Y", "Ganai RA", "Kara HO", "Yu JR", "Lee CH", "Stafford J", "Shilatifard A", "Reinberg D" ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Science advances", "doi": "10.1126/sciadv.aay3068", "pmid": 31616795, "url": "https://doi.org/10.1126/sciadv.aay3068", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "LEDGF and HDGF2 nucleosome-dependent transcription", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "source_records": [ { "reference_id": "PMID:31616795", "year": 2019, "source_type": "primary_experimental_research", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "url": "https://doi.org/10.1126/sciadv.aay3068" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" }, { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1126/sciadv.aay3068", "kind": "publication", "kind_label": "Publication year", "date": "2019", "sort_date": "2019-00-00" }, { "id": "REF:PDB:6IIP:primary", "reference_id": "REF:PDB:6IIP:primary", "reference_ids": [ "REF:PDB:6IIP:primary" ], "title": "Apo-form structure of the HRP3 PWWP domain", "authors": [ "Wang, Z.", "Tian, W." ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Nucleic Acids Res.", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/6IIP", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:6IIP:primary", "year": 2019, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/6IIP" } ], "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIP", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:REF:PDB:6IIP:primary", "kind": "publication", "kind_label": "Publication year", "date": "2019", "sort_date": "2019-00-00" }, { "id": "REF:PDB:6IIQ:primary", "reference_id": "REF:PDB:6IIQ:primary", "reference_ids": [ "REF:PDB:6IIQ:primary" ], "title": "Complex structure of the HRP3 PWWP domain with a 16-bp TA-rich DNA", "authors": [ "Wang, Z.", "Tian, W." ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Nucleic Acids Res.", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/6IIQ", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:6IIQ:primary", "year": 2019, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/6IIQ" } ], "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIQ", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:REF:PDB:6IIQ:primary", "kind": "publication", "kind_label": "Publication year", "date": "2019", "sort_date": "2019-00-00" }, { "id": "REF:PDB:6IIR:primary", "reference_id": "REF:PDB:6IIR:primary", "reference_ids": [ "REF:PDB:6IIR:primary" ], "title": "Complex structure of the HRP3 PWWP domain with a 10-bp GC-rich DNA", "authors": [ "Wang, Z.", "Tian, W." ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Nucleic Acids Res.", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/6IIR", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:6IIR:primary", "year": 2019, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/6IIR" } ], "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIR", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:REF:PDB:6IIR:primary", "kind": "publication", "kind_label": "Publication year", "date": "2019", "sort_date": "2019-00-00" }, { "id": "REF:PDB:6IIS:primary", "reference_id": "REF:PDB:6IIS:primary", "reference_ids": [ "REF:PDB:6IIS:primary" ], "title": "Complex structure of the HRP3 PWWP domain with both a 16-bp TA-rich DNA and an H3K36me3-containing histone peptide", "authors": [ "Wang, Z.", "Tian, W." ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Nucleic Acids Res.", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/6IIS", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:6IIS:primary", "year": 2019, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/6IIS" } ], "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIS", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:REF:PDB:6IIS:primary", "kind": "publication", "kind_label": "Publication year", "date": "2019", "sort_date": "2019-00-00" }, { "id": "REF:PDB:6IIT:primary", "reference_id": "REF:PDB:6IIT:primary", "reference_ids": [ "REF:PDB:6IIT:primary" ], "title": "Complex structure of the HRP3 PWWP domain with both a 16-bp TA-rich DNA and a H3K36me2-containing histone peptide", "authors": [ "Wang, Z.", "Tian, W." ], "year": 2019, "year_values": [ 2019 ], "year_conflict": false, "journal": "Nucleic Acids Res.", "doi": null, "pmid": null, "url": "https://www.rcsb.org/structure/6IIT", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:6IIT:primary", "year": 2019, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://www.rcsb.org/structure/6IIT" } ], "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIT", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:REF:PDB:6IIT:primary", "kind": "publication", "kind_label": "Publication year", "date": "2019", "sort_date": "2019-00-00" }, { "event_id": "PDB:6R3E:deposition", "id": "6R3E", "kind": "deposition", "kind_label": "PDB deposition", "date": "2019-03-20", "sort_date": "2019-03-20", "year": 2019, "title": "Human DNMT3B PWWP domain in complex with triisopropanolamine", "url": "https://www.rcsb.org/structure/6R3E", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6R3E", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:6R3E:primary", "title": "Targeting PWWP domain of DNMT3B for epigenetic cancer therapy: identification and structural characterization of potential protein-protein interaction inhibitors", "url": "https://www.rcsb.org/structure/6R3E", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2019-03-20T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6IIP:release", "id": "6IIP", "kind": "release", "kind_label": "PDB initial release", "date": "2019-04-24", "sort_date": "2019-04-24", "year": 2019, "title": "Apo-form structure of the HRP3 PWWP domain", "url": "https://www.rcsb.org/structure/6IIP", "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIP", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y3E1:PWWP1", "gene": "HDGFL3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkz294", "title": "The HRP3 PWWP domain recognizes the minor groove of double-stranded DNA and recruits HRP3 to chromatin.", "url": "https://doi.org/10.1093/nar/gkz294", "doi": "10.1093/nar/gkz294", "pmid": 31162607, "year": 2019 }, { "id": "REF:PDB:6IIP:primary", "title": "Apo-form structure of the HRP3 PWWP domain", "url": "https://www.rcsb.org/structure/6IIP", "doi": null, "pmid": null, "year": 2019 } ], "date_precision": "day", "source_date": "2019-04-24T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6IIQ:release", "id": "6IIQ", "kind": "release", "kind_label": "PDB initial release", "date": "2019-04-24", "sort_date": "2019-04-24", "year": 2019, "title": "Complex structure of the HRP3 PWWP domain with a 16-bp TA-rich DNA", "url": "https://www.rcsb.org/structure/6IIQ", "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIQ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y3E1:PWWP1", "gene": "HDGFL3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkz294", "title": "The HRP3 PWWP domain recognizes the minor groove of double-stranded DNA and recruits HRP3 to chromatin.", "url": "https://doi.org/10.1093/nar/gkz294", "doi": "10.1093/nar/gkz294", "pmid": 31162607, "year": 2019 }, { "id": "REF:PDB:6IIQ:primary", "title": "Complex structure of the HRP3 PWWP domain with a 16-bp TA-rich DNA", "url": "https://www.rcsb.org/structure/6IIQ", "doi": null, "pmid": null, "year": 2019 } ], "date_precision": "day", "source_date": "2019-04-24T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6IIR:release", "id": "6IIR", "kind": "release", "kind_label": "PDB initial release", "date": "2019-04-24", "sort_date": "2019-04-24", "year": 2019, "title": "Complex structure of the HRP3 PWWP domain with a 10-bp GC-rich DNA", "url": "https://www.rcsb.org/structure/6IIR", "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIR", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y3E1:PWWP1", "gene": "HDGFL3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkz294", "title": "The HRP3 PWWP domain recognizes the minor groove of double-stranded DNA and recruits HRP3 to chromatin.", "url": "https://doi.org/10.1093/nar/gkz294", "doi": "10.1093/nar/gkz294", "pmid": 31162607, "year": 2019 }, { "id": "REF:PDB:6IIR:primary", "title": "Complex structure of the HRP3 PWWP domain with a 10-bp GC-rich DNA", "url": "https://www.rcsb.org/structure/6IIR", "doi": null, "pmid": null, "year": 2019 } ], "date_precision": "day", "source_date": "2019-04-24T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6IIS:release", "id": "6IIS", "kind": "release", "kind_label": "PDB initial release", "date": "2019-04-24", "sort_date": "2019-04-24", "year": 2019, "title": "Complex structure of the HRP3 PWWP domain with both a 16-bp TA-rich DNA and an H3K36me3-containing histone peptide", "url": "https://www.rcsb.org/structure/6IIS", "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIS", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y3E1:PWWP1", "gene": "HDGFL3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkz294", "title": "The HRP3 PWWP domain recognizes the minor groove of double-stranded DNA and recruits HRP3 to chromatin.", "url": "https://doi.org/10.1093/nar/gkz294", "doi": "10.1093/nar/gkz294", "pmid": 31162607, "year": 2019 }, { "id": "REF:PDB:6IIS:primary", "title": "Complex structure of the HRP3 PWWP domain with both a 16-bp TA-rich DNA and an H3K36me3-containing histone peptide", "url": "https://www.rcsb.org/structure/6IIS", "doi": null, "pmid": null, "year": 2019 } ], "date_precision": "day", "source_date": "2019-04-24T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6IIT:release", "id": "6IIT", "kind": "release", "kind_label": "PDB initial release", "date": "2019-04-24", "sort_date": "2019-04-24", "year": 2019, "title": "Complex structure of the HRP3 PWWP domain with both a 16-bp TA-rich DNA and an H3K36me2-containing histone peptide", "url": "https://www.rcsb.org/structure/6IIT", "proteins": [ { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6IIT", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y3E1:PWWP1", "gene": "HDGFL3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkz294", "title": "The HRP3 PWWP domain recognizes the minor groove of double-stranded DNA and recruits HRP3 to chromatin.", "url": "https://doi.org/10.1093/nar/gkz294", "doi": "10.1093/nar/gkz294", "pmid": 31162607, "year": 2019 }, { "id": "REF:PDB:6IIT:primary", "title": "Complex structure of the HRP3 PWWP domain with both a 16-bp TA-rich DNA and a H3K36me2-containing histone peptide", "url": "https://www.rcsb.org/structure/6IIT", "doi": null, "pmid": null, "year": 2019 } ], "date_precision": "day", "source_date": "2019-04-24T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6OQM:deposition", "id": "6OQM", "kind": "deposition", "kind_label": "PDB deposition", "date": "2019-04-26", "sort_date": "2019-04-26", "year": 2019, "title": "crystal structure of the MSH6 PWWP domain", "url": "https://www.rcsb.org/structure/6OQM", "proteins": [ { "protein_id": "UP:P52701", "uniprot": "P52701", "gene": "MSH6", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6OQM", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P52701:PWWP1", "gene": "MSH6", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:6OQM:primary", "title": "crystal structure of the MSH6 PWWP domain", "url": "https://www.rcsb.org/structure/6OQM", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2019-04-26T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6OQM:release", "id": "6OQM", "kind": "release", "kind_label": "PDB initial release", "date": "2019-05-29", "sort_date": "2019-05-29", "year": 2019, "title": "crystal structure of the MSH6 PWWP domain", "url": "https://www.rcsb.org/structure/6OQM", "proteins": [ { "protein_id": "UP:P52701", "uniprot": "P52701", "gene": "MSH6", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6OQM", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P52701:PWWP1", "gene": "MSH6", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:6OQM:primary", "title": "crystal structure of the MSH6 PWWP domain", "url": "https://www.rcsb.org/structure/6OQM", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2019-05-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6PA7:deposition", "id": "6PA7", "kind": "deposition", "kind_label": "PDB deposition", "date": "2019-06-11", "sort_date": "2019-06-11", "year": 2019, "title": "The cryo-EM structure of the human DNMT3A2-DNMT3B3 complex bound to nucleosome.", "url": "https://www.rcsb.org/structure/6PA7", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6PA7", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41586-020-2747-1", "title": "Structure of nucleosome-bound DNA methyltransferases DNMT3A and DNMT3B.", "url": "https://doi.org/10.1038/s41586-020-2747-1", "doi": "10.1038/s41586-020-2747-1", "pmid": 32968275, "year": 2020 } ], "date_precision": "day", "source_date": "2019-06-11T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:6S01:deposition", "id": "6S01", "kind": "deposition", "kind_label": "PDB deposition", "date": "2019-06-13", "sort_date": "2019-06-13", "year": 2019, "title": "Structure of LEDGF PWWP domain bound H3K36 methylated nucleosome", "url": "https://www.rcsb.org/structure/6S01", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6S01", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41594-019-0345-4", "title": "Structure of H3K36-methylated nucleosome-PWWP complex reveals multivalent cross-gyre binding.", "url": "https://doi.org/10.1038/s41594-019-0345-4", "doi": "10.1038/s41594-019-0345-4", "pmid": 31819277, "year": 2020 } ], "date_precision": "day", "source_date": "2019-06-13T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G24:release", "id": "6G24", "kind": "release", "kind_label": "PDB initial release", "date": "2019-06-26", "sort_date": "2019-06-26", "year": 2019, "title": "X-ray structure of NSD3-PWWP1 in complex with compound 3", "url": "https://www.rcsb.org/structure/6G24", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G24", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2019-06-26T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G25:release", "id": "6G25", "kind": "release", "kind_label": "PDB initial release", "date": "2019-06-26", "sort_date": "2019-06-26", "year": 2019, "title": "X-ray structure of NSD3-PWWP1 in complex with compound 4", "url": "https://www.rcsb.org/structure/6G25", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G25", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2019-06-26T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G27:release", "id": "6G27", "kind": "release", "kind_label": "PDB initial release", "date": "2019-06-26", "sort_date": "2019-06-26", "year": 2019, "title": "X-ray structure of NSD3-PWWP1 in complex with compound 5", "url": "https://www.rcsb.org/structure/6G27", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G27", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2019-06-26T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G29:release", "id": "6G29", "kind": "release", "kind_label": "PDB initial release", "date": "2019-06-26", "sort_date": "2019-06-26", "year": 2019, "title": "X-ray structure of NSD3-PWWP1 in complex with compound 6", "url": "https://www.rcsb.org/structure/6G29", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G29", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2019-06-26T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G2B:release", "id": "6G2B", "kind": "release", "kind_label": "PDB initial release", "date": "2019-06-26", "sort_date": "2019-06-26", "year": 2019, "title": "X-ray structure of NSD3-PWWP1 in complex with compound 8", "url": "https://www.rcsb.org/structure/6G2B", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G2B", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2019-06-26T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G2C:release", "id": "6G2C", "kind": "release", "kind_label": "PDB initial release", "date": "2019-06-26", "sort_date": "2019-06-26", "year": 2019, "title": "X-ray structure of NSD3-PWWP1 in complex with compound 9", "url": "https://www.rcsb.org/structure/6G2C", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G2C", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2019-06-26T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G2E:release", "id": "6G2E", "kind": "release", "kind_label": "PDB initial release", "date": "2019-06-26", "sort_date": "2019-06-26", "year": 2019, "title": "X-ray structure of NSD3-PWWP1 in complex with compound 13", "url": "https://www.rcsb.org/structure/6G2E", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G2E", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2019-06-26T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G2F:release", "id": "6G2F", "kind": "release", "kind_label": "PDB initial release", "date": "2019-06-26", "sort_date": "2019-06-26", "year": 2019, "title": "X-ray structure of NSD3-PWWP1 in complex with compound 16", "url": "https://www.rcsb.org/structure/6G2F", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G2F", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2019-06-26T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G2O:release", "id": "6G2O", "kind": "release", "kind_label": "PDB initial release", "date": "2019-06-26", "sort_date": "2019-06-26", "year": 2019, "title": "X-ray structure of NSD3-PWWP1 in complex with compound BI-9321", "url": "https://www.rcsb.org/structure/6G2O", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G2O", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2019-06-26T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G3P:release", "id": "6G3P", "kind": "release", "kind_label": "PDB initial release", "date": "2019-06-26", "sort_date": "2019-06-26", "year": 2019, "title": "X-ray structure of seleno-methionine labelled NSD3-PWWP1", "url": "https://www.rcsb.org/structure/6G3P", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G3P", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2019-06-26T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6G3T:release", "id": "6G3T", "kind": "release", "kind_label": "PDB initial release", "date": "2019-06-26", "sort_date": "2019-06-26", "year": 2019, "title": "X-ray structure of NSD3-PWWP1", "url": "https://www.rcsb.org/structure/6G3T", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6G3T", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-019-0310-x", "title": "Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3.", "url": "https://doi.org/10.1038/s41589-019-0310-x", "doi": "10.1038/s41589-019-0310-x", "pmid": 31285596, "year": 2019 } ], "date_precision": "day", "source_date": "2019-06-26T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6KCO:deposition", "id": "6KCO", "kind": "deposition", "kind_label": "PDB deposition", "date": "2019-06-28", "sort_date": "2019-06-28", "year": 2019, "title": "Shuguo PWWP in complex with ssDNA", "url": "https://www.rcsb.org/structure/6KCO", "proteins": [ { "protein_id": "UP:Q9VAA9", "uniprot": "Q9VAA9", "gene": "Jasper", "organism": "Drosophila melanogaster" } ], "structures": [ { "pdb_id": "6KCO", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9VAA9:PWWP1", "gene": "Jasper", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s42003-025-07895-2", "title": "Structural basis of thymidine-rich DNA recognition by Drosophila P75 PWWP domain.", "url": "https://doi.org/10.1038/s42003-025-07895-2", "doi": "10.1038/s42003-025-07895-2", "pmid": 40089621, "year": 2025 }, { "id": "REF:PDB:6KCO:primary", "title": "Shuguo PWWP in complex with ssDNA", "url": "https://www.rcsb.org/structure/6KCO", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2019-06-28T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6KCP:deposition", "id": "6KCP", "kind": "deposition", "kind_label": "PDB deposition", "date": "2019-06-28", "sort_date": "2019-06-28", "year": 2019, "title": "Shuguo PWWP in complex with ssDNA", "url": "https://www.rcsb.org/structure/6KCP", "proteins": [ { "protein_id": "UP:Q9VAA9", "uniprot": "Q9VAA9", "gene": "Jasper", "organism": "Drosophila melanogaster" } ], "structures": [ { "pdb_id": "6KCP", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9VAA9:PWWP1", "gene": "Jasper", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:6KCP:primary", "title": "Shuguo PWWP in complex with ssDNA", "url": "https://www.rcsb.org/structure/6KCP", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2019-06-28T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6KCU:deposition", "id": "6KCU", "kind": "deposition", "kind_label": "PDB deposition", "date": "2019-06-29", "sort_date": "2019-06-29", "year": 2019, "title": "Shuguo PWWP domain", "url": "https://www.rcsb.org/structure/6KCU", "proteins": [ { "protein_id": "UP:Q9VAA9", "uniprot": "Q9VAA9", "gene": "Jasper", "organism": "Drosophila melanogaster" } ], "structures": [ { "pdb_id": "6KCU", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9VAA9:PWWP1", "gene": "Jasper", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:6KCU:primary", "title": "Shuguo PWWP domain", "url": "https://www.rcsb.org/structure/6KCU", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2019-06-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6KD6:deposition", "id": "6KD6", "kind": "deposition", "kind_label": "PDB deposition", "date": "2019-07-01", "sort_date": "2019-07-01", "year": 2019, "title": "Shuguo PWWP domain", "url": "https://www.rcsb.org/structure/6KD6", "proteins": [ { "protein_id": "UP:Q9VAA9", "uniprot": "Q9VAA9", "gene": "Jasper", "organism": "Drosophila melanogaster" } ], "structures": [ { "pdb_id": "6KD6", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9VAA9:PWWP1", "gene": "Jasper", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s42003-025-07895-2", "title": "Structural basis of thymidine-rich DNA recognition by Drosophila P75 PWWP domain.", "url": "https://doi.org/10.1038/s42003-025-07895-2", "doi": "10.1038/s42003-025-07895-2", "pmid": 40089621, "year": 2025 }, { "id": "REF:PDB:6KD6:primary", "title": "Shuguo PWWP domain", "url": "https://www.rcsb.org/structure/6KD6", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2019-07-01T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6UE6:deposition", "id": "6UE6", "kind": "deposition", "kind_label": "PDB deposition", "date": "2019-09-20", "sort_date": "2019-09-20", "year": 2019, "title": "PWWP1 domain of NSD2 in complex with MR837", "url": "https://www.rcsb.org/structure/6UE6", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6UE6", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acs.jmedchem.0c01768", "title": "Discovery of Small-Molecule Antagonists of the PWWP Domain of NSD2.", "url": "https://doi.org/10.1021/acs.jmedchem.0c01768", "doi": "10.1021/acs.jmedchem.0c01768", "pmid": 33522809, "year": 2021 } ], "date_precision": "day", "source_date": "2019-09-20T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6L87:deposition", "id": "6L87", "kind": "deposition", "kind_label": "PDB deposition", "date": "2019-11-05", "sort_date": "2019-11-05", "year": 2019, "title": "Solution structure of the tandem PWWP-ARID domains of human RBBP1", "url": "https://www.rcsb.org/structure/6L87", "proteins": [ { "protein_id": "UP:P29374", "uniprot": "P29374", "gene": "ARID4A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6L87", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P29374:PWWP1", "gene": "ARID4A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.jmb.2021.167224", "title": "Structural Insight into Chromatin Recognition by Multiple Domains of the Tumor Suppressor RBBP1.", "url": "https://doi.org/10.1016/j.jmb.2021.167224", "doi": "10.1016/j.jmb.2021.167224", "pmid": 34506790, "year": 2021 } ], "date_precision": "day", "source_date": "2019-11-05T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6UE6:release", "id": "6UE6", "kind": "release", "kind_label": "PDB initial release", "date": "2019-11-13", "sort_date": "2019-11-13", "year": 2019, "title": "PWWP1 domain of NSD2 in complex with MR837", "url": "https://www.rcsb.org/structure/6UE6", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6UE6", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acs.jmedchem.0c01768", "title": "Discovery of Small-Molecule Antagonists of the PWWP Domain of NSD2.", "url": "https://doi.org/10.1021/acs.jmedchem.0c01768", "doi": "10.1021/acs.jmedchem.0c01768", "pmid": 33522809, "year": 2021 } ], "date_precision": "day", "source_date": "2019-11-13T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6S01:release", "id": "6S01", "kind": "release", "kind_label": "PDB initial release", "date": "2019-12-18", "sort_date": "2019-12-18", "year": 2019, "title": "Structure of LEDGF PWWP domain bound H3K36 methylated nucleosome", "url": "https://www.rcsb.org/structure/6S01", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6S01", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41594-019-0345-4", "title": "Structure of H3K36-methylated nucleosome-PWWP complex reveals multivalent cross-gyre binding.", "url": "https://doi.org/10.1038/s41594-019-0345-4", "doi": "10.1038/s41594-019-0345-4", "pmid": 31819277, "year": 2020 } ], "date_precision": "day", "source_date": "2019-12-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1038/s41467-020-18874-y", "reference_id": "REF:PDB:7PEL:primary", "reference_ids": [ "REF:PDB:7PEL:primary" ], "title": "Cryo-EM structure of the deltaretroviral intasome in complex with the PP2A regulatory subunit B56gamma.", "authors": [ "Barski, M.S.", "Minnell, J.J.", "Hodakova, Z.", "Pye, V.E.", "Nans, A.", "Cherepanov, P.", "Maertens, G.N." ], "year": 2020, "year_values": [ 2020 ], "year_conflict": false, "journal": "Nat Commun", "doi": "10.1038/s41467-020-18874-y", "pmid": 33028863, "url": "https://doi.org/10.1038/s41467-020-18874-y", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:7PEL:primary", "year": 2020, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1038/s41467-020-18874-y" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7PEL", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/s41467-020-18874-y", "kind": "publication", "kind_label": "Publication year", "date": "2020", "sort_date": "2020-00-00" }, { "id": "DOI:10.1038/s41586-020-2747-1", "reference_id": "PMID:32968275", "reference_ids": [ "PMID:32968275" ], "title": "Structure of nucleosome-bound DNA methyltransferases DNMT3A and DNMT3B.", "authors": [ "Xu TH", "Liu M", "Zhou XE", "Liang G", "Zhao G", "Xu HE", "Melcher K", "Jones PA" ], "year": 2020, "year_values": [ 2020 ], "year_conflict": false, "journal": "Nature", "doi": "10.1038/s41586-020-2747-1", "pmid": 32968275, "url": "https://doi.org/10.1038/s41586-020-2747-1", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "DNMT3A2-DNMT3B3-nucleosome cryo-EM context; PWWP coordinate inclusion must be checked", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:32968275", "year": 2020, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1038/s41586-020-2747-1" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6PA7", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/s41586-020-2747-1", "kind": "publication", "kind_label": "Publication year", "date": "2020", "sort_date": "2020-00-00" }, { "id": "DOI:10.1038/s41594-019-0345-4", "reference_id": "PMID:31819277", "reference_ids": [ "PMID:31819277" ], "title": "Structure of H3K36-methylated nucleosome-PWWP complex reveals multivalent cross-gyre binding.", "authors": [ "Wang H", "Farnung L", "Dienemann C", "Cramer P" ], "year": 2020, "year_values": [ 2020 ], "year_conflict": false, "journal": "Nature structural & molecular biology", "doi": "10.1038/s41594-019-0345-4", "pmid": 31819277, "url": "https://doi.org/10.1038/s41594-019-0345-4", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP-nucleosome cryo-EM structure and cross-gyre DNA binding", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:31819277", "year": 2020, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1038/s41594-019-0345-4" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6S01", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/s41594-019-0345-4", "kind": "publication", "kind_label": "Publication year", "date": "2020", "sort_date": "2020-00-00" }, { "event_id": "PDB:6R3E:release", "id": "6R3E", "kind": "release", "kind_label": "PDB initial release", "date": "2020-04-08", "sort_date": "2020-04-08", "year": 2020, "title": "Human DNMT3B PWWP domain in complex with triisopropanolamine", "url": "https://www.rcsb.org/structure/6R3E", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6R3E", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:6R3E:primary", "title": "Targeting PWWP domain of DNMT3B for epigenetic cancer therapy: identification and structural characterization of potential protein-protein interaction inhibitors", "url": "https://www.rcsb.org/structure/6R3E", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2020-04-08T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6XCG:deposition", "id": "6XCG", "kind": "deposition", "kind_label": "PDB deposition", "date": "2020-06-08", "sort_date": "2020-06-08", "year": 2020, "title": "Histone-lysine N-methyltransferase NSD2-PWWP1 with compound UNC6934", "url": "https://www.rcsb.org/structure/6XCG", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6XCG", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-021-00898-0", "title": "A chemical probe targeting the PWWP domain alters NSD2 nucleolar localization.", "url": "https://doi.org/10.1038/s41589-021-00898-0", "doi": "10.1038/s41589-021-00898-0", "pmid": 34782742, "year": 2022 } ], "date_precision": "day", "source_date": "2020-06-08T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6PA7:release", "id": "6PA7", "kind": "release", "kind_label": "PDB initial release", "date": "2020-06-17", "sort_date": "2020-06-17", "year": 2020, "title": "The cryo-EM structure of the human DNMT3A2-DNMT3B3 complex bound to nucleosome.", "url": "https://www.rcsb.org/structure/6PA7", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6PA7", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41586-020-2747-1", "title": "Structure of nucleosome-bound DNA methyltransferases DNMT3A and DNMT3B.", "url": "https://doi.org/10.1038/s41586-020-2747-1", "doi": "10.1038/s41586-020-2747-1", "pmid": 32968275, "year": 2020 } ], "date_precision": "day", "source_date": "2020-06-17T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:6KCO:release", "id": "6KCO", "kind": "release", "kind_label": "PDB initial release", "date": "2020-07-01", "sort_date": "2020-07-01", "year": 2020, "title": "Shuguo PWWP in complex with ssDNA", "url": "https://www.rcsb.org/structure/6KCO", "proteins": [ { "protein_id": "UP:Q9VAA9", "uniprot": "Q9VAA9", "gene": "Jasper", "organism": "Drosophila melanogaster" } ], "structures": [ { "pdb_id": "6KCO", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9VAA9:PWWP1", "gene": "Jasper", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s42003-025-07895-2", "title": "Structural basis of thymidine-rich DNA recognition by Drosophila P75 PWWP domain.", "url": "https://doi.org/10.1038/s42003-025-07895-2", "doi": "10.1038/s42003-025-07895-2", "pmid": 40089621, "year": 2025 }, { "id": "REF:PDB:6KCO:primary", "title": "Shuguo PWWP in complex with ssDNA", "url": "https://www.rcsb.org/structure/6KCO", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2020-07-01T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6KCP:release", "id": "6KCP", "kind": "release", "kind_label": "PDB initial release", "date": "2020-07-01", "sort_date": "2020-07-01", "year": 2020, "title": "Shuguo PWWP in complex with ssDNA", "url": "https://www.rcsb.org/structure/6KCP", "proteins": [ { "protein_id": "UP:Q9VAA9", "uniprot": "Q9VAA9", "gene": "Jasper", "organism": "Drosophila melanogaster" } ], "structures": [ { "pdb_id": "6KCP", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9VAA9:PWWP1", "gene": "Jasper", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:6KCP:primary", "title": "Shuguo PWWP in complex with ssDNA", "url": "https://www.rcsb.org/structure/6KCP", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2020-07-01T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6KCU:release", "id": "6KCU", "kind": "release", "kind_label": "PDB initial release", "date": "2020-07-01", "sort_date": "2020-07-01", "year": 2020, "title": "Shuguo PWWP domain", "url": "https://www.rcsb.org/structure/6KCU", "proteins": [ { "protein_id": "UP:Q9VAA9", "uniprot": "Q9VAA9", "gene": "Jasper", "organism": "Drosophila melanogaster" } ], "structures": [ { "pdb_id": "6KCU", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9VAA9:PWWP1", "gene": "Jasper", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:6KCU:primary", "title": "Shuguo PWWP domain", "url": "https://www.rcsb.org/structure/6KCU", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2020-07-01T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6KD6:release", "id": "6KD6", "kind": "release", "kind_label": "PDB initial release", "date": "2020-07-01", "sort_date": "2020-07-01", "year": 2020, "title": "Shuguo PWWP domain", "url": "https://www.rcsb.org/structure/6KD6", "proteins": [ { "protein_id": "UP:Q9VAA9", "uniprot": "Q9VAA9", "gene": "Jasper", "organism": "Drosophila melanogaster" } ], "structures": [ { "pdb_id": "6KD6", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9VAA9:PWWP1", "gene": "Jasper", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s42003-025-07895-2", "title": "Structural basis of thymidine-rich DNA recognition by Drosophila P75 PWWP domain.", "url": "https://doi.org/10.1038/s42003-025-07895-2", "doi": "10.1038/s42003-025-07895-2", "pmid": 40089621, "year": 2025 }, { "id": "REF:PDB:6KD6:primary", "title": "Shuguo PWWP domain", "url": "https://www.rcsb.org/structure/6KD6", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2020-07-01T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:6XCG:release", "id": "6XCG", "kind": "release", "kind_label": "PDB initial release", "date": "2020-07-22", "sort_date": "2020-07-22", "year": 2020, "title": "Histone-lysine N-methyltransferase NSD2-PWWP1 with compound UNC6934", "url": "https://www.rcsb.org/structure/6XCG", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6XCG", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-021-00898-0", "title": "A chemical probe targeting the PWWP domain alters NSD2 nucleolar localization.", "url": "https://doi.org/10.1038/s41589-021-00898-0", "doi": "10.1038/s41589-021-00898-0", "pmid": 34782742, "year": 2022 } ], "date_precision": "day", "source_date": "2020-07-22T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7CRO:deposition", "id": "7CRO", "kind": "deposition", "kind_label": "PDB deposition", "date": "2020-08-14", "sort_date": "2020-08-14", "year": 2020, "title": "NSD2 bearing E1099K/T1150A dual mutation in complex with 187-bp NCP", "url": "https://www.rcsb.org/structure/7CRO", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7CRO", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41586-020-03069-8", "title": "Molecular basis of nucleosomal H3K36 methylation by NSD methyltransferases.", "url": "https://doi.org/10.1038/s41586-020-03069-8", "doi": "10.1038/s41586-020-03069-8", "pmid": 33361816, "year": 2021 } ], "date_precision": "day", "source_date": "2020-08-14T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:7CRP:deposition", "id": "7CRP", "kind": "deposition", "kind_label": "PDB deposition", "date": "2020-08-14", "sort_date": "2020-08-14", "year": 2020, "title": "NSD3 bearing E1181K/T1232A dual mutation in complex with 187-bp NCP (1:1 binding mode)", "url": "https://www.rcsb.org/structure/7CRP", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7CRP", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41586-020-03069-8", "title": "Molecular basis of nucleosomal H3K36 methylation by NSD methyltransferases.", "url": "https://doi.org/10.1038/s41586-020-03069-8", "doi": "10.1038/s41586-020-03069-8", "pmid": 33361816, "year": 2021 } ], "date_precision": "day", "source_date": "2020-08-14T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:7CRQ:deposition", "id": "7CRQ", "kind": "deposition", "kind_label": "PDB deposition", "date": "2020-08-14", "sort_date": "2020-08-14", "year": 2020, "title": "NSD3 bearing E1181K/T1232A dual mutation in complex with 187-bp NCP (2:1 binding mode)", "url": "https://www.rcsb.org/structure/7CRQ", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7CRQ", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41586-020-03069-8", "title": "Molecular basis of nucleosomal H3K36 methylation by NSD methyltransferases.", "url": "https://doi.org/10.1038/s41586-020-03069-8", "doi": "10.1038/s41586-020-03069-8", "pmid": 33361816, "year": 2021 } ], "date_precision": "day", "source_date": "2020-08-14T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:7CRR:deposition", "id": "7CRR", "kind": "deposition", "kind_label": "PDB deposition", "date": "2020-08-14", "sort_date": "2020-08-14", "year": 2020, "title": "Native NSD3 bound to 187-bp nucleosome", "url": "https://www.rcsb.org/structure/7CRR", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7CRR", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41586-020-03069-8", "title": "Molecular basis of nucleosomal H3K36 methylation by NSD methyltransferases.", "url": "https://doi.org/10.1038/s41586-020-03069-8", "doi": "10.1038/s41586-020-03069-8", "pmid": 33361816, "year": 2021 } ], "date_precision": "day", "source_date": "2020-08-14T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:7CRO:release", "id": "7CRO", "kind": "release", "kind_label": "PDB initial release", "date": "2020-10-21", "sort_date": "2020-10-21", "year": 2020, "title": "NSD2 bearing E1099K/T1150A dual mutation in complex with 187-bp NCP", "url": "https://www.rcsb.org/structure/7CRO", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7CRO", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41586-020-03069-8", "title": "Molecular basis of nucleosomal H3K36 methylation by NSD methyltransferases.", "url": "https://doi.org/10.1038/s41586-020-03069-8", "doi": "10.1038/s41586-020-03069-8", "pmid": 33361816, "year": 2021 } ], "date_precision": "day", "source_date": "2020-10-21T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:7CRP:release", "id": "7CRP", "kind": "release", "kind_label": "PDB initial release", "date": "2020-10-21", "sort_date": "2020-10-21", "year": 2020, "title": "NSD3 bearing E1181K/T1232A dual mutation in complex with 187-bp NCP (1:1 binding mode)", "url": "https://www.rcsb.org/structure/7CRP", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7CRP", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41586-020-03069-8", "title": "Molecular basis of nucleosomal H3K36 methylation by NSD methyltransferases.", "url": "https://doi.org/10.1038/s41586-020-03069-8", "doi": "10.1038/s41586-020-03069-8", "pmid": 33361816, "year": 2021 } ], "date_precision": "day", "source_date": "2020-10-21T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:7CRQ:release", "id": "7CRQ", "kind": "release", "kind_label": "PDB initial release", "date": "2020-10-21", "sort_date": "2020-10-21", "year": 2020, "title": "NSD3 bearing E1181K/T1232A dual mutation in complex with 187-bp NCP (2:1 binding mode)", "url": "https://www.rcsb.org/structure/7CRQ", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7CRQ", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41586-020-03069-8", "title": "Molecular basis of nucleosomal H3K36 methylation by NSD methyltransferases.", "url": "https://doi.org/10.1038/s41586-020-03069-8", "doi": "10.1038/s41586-020-03069-8", "pmid": 33361816, "year": 2021 } ], "date_precision": "day", "source_date": "2020-10-21T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:7CRR:release", "id": "7CRR", "kind": "release", "kind_label": "PDB initial release", "date": "2020-10-21", "sort_date": "2020-10-21", "year": 2020, "title": "Native NSD3 bound to 187-bp nucleosome", "url": "https://www.rcsb.org/structure/7CRR", "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7CRR", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41586-020-03069-8", "title": "Molecular basis of nucleosomal H3K36 methylation by NSD methyltransferases.", "url": "https://doi.org/10.1038/s41586-020-03069-8", "doi": "10.1038/s41586-020-03069-8", "pmid": 33361816, "year": 2021 } ], "date_precision": "day", "source_date": "2020-10-21T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "id": "DOI:10.1016/j.bbagrm.2021.194688", "reference_id": "PMID:33556623", "reference_ids": [ "PMID:33556623" ], "title": "Crystal structure of the BRPF2 PWWP domain in complex with DNA reveals a different binding mode than the HDGF family of PWWP domains.", "authors": [ "Zhang M", "Lei M", "Qin S", "Dong A", "Yang A", "Li Y", "Loppnau P", "Hughes TR", "Min J", "Liu Y" ], "year": 2021, "year_values": [ 2021 ], "year_conflict": false, "journal": "Biochimica et biophysica acta. Gene regulatory mechanisms", "doi": "10.1016/j.bbagrm.2021.194688", "pmid": 33556623, "url": "https://doi.org/10.1016/j.bbagrm.2021.194688", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "BRPF2 PWWP-DNA crystal structure", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:33556623", "year": 2021, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.bbagrm.2021.194688" } ], "proteins": [ { "protein_id": "UP:O95696", "uniprot": "O95696", "gene": "BRD1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7LH9", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.bbagrm.2021.194688", "kind": "publication", "kind_label": "Publication year", "date": "2021", "sort_date": "2021-00-00" }, { "id": "DOI:10.1016/j.bbrc.2021.07.017", "reference_id": "PMID:34271259", "reference_ids": [ "PMID:34271259" ], "title": "Histone and DNA binding ability studies of the NSD subfamily of PWWP domains.", "authors": [ "Zhang M", "Yang Y", "Zhou M", "Dong A", "Yan X", "Loppnau P", "Min J", "Liu Y" ], "year": 2021, "year_values": [ 2021 ], "year_conflict": false, "journal": "Biochemical and biophysical research communications", "doi": "10.1016/j.bbrc.2021.07.017", "pmid": 34271259, "url": "https://doi.org/10.1016/j.bbrc.2021.07.017", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "NSD-family PWWP histone and DNA-binding comparison", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:34271259", "year": 2021, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.bbrc.2021.07.017" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" }, { "protein_id": "UP:Q96L73", "uniprot": "Q96L73", "gene": "NSD1", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "4RXJ", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "5VC8", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.bbrc.2021.07.017", "kind": "publication", "kind_label": "Publication year", "date": "2021", "sort_date": "2021-00-00" }, { "id": "DOI:10.1016/j.jmb.2021.167224", "reference_id": "PMID:34506790", "reference_ids": [ "PMID:34506790" ], "title": "Structural Insight into Chromatin Recognition by Multiple Domains of the Tumor Suppressor RBBP1.", "authors": [ "Gong W", "Liang Q", "Tong Y", "Perrett S", "Feng Y" ], "year": 2021, "year_values": [ 2021 ], "year_conflict": false, "journal": "Journal of molecular biology", "doi": "10.1016/j.jmb.2021.167224", "pmid": 34506790, "url": "https://doi.org/10.1016/j.jmb.2021.167224", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Experimental solution structure of engineered tandem PWWP–ARID; PDB 6L87", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:34506790", "year": 2021, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1016/j.jmb.2021.167224" } ], "proteins": [ { "protein_id": "UP:P29374", "uniprot": "P29374", "gene": "ARID4A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6L87", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.jmb.2021.167224", "kind": "publication", "kind_label": "Publication year", "date": "2021", "sort_date": "2021-00-00" }, { "id": "DOI:10.1021/acs.jmedchem.0c01768", "reference_id": "PMID:33522809", "reference_ids": [ "PMID:33522809" ], "title": "Discovery of Small-Molecule Antagonists of the PWWP Domain of NSD2.", "authors": [ "Ferreira de Freitas R", "Liu Y", "Szewczyk MM", "Mehta N", "Li F", "McLeod D", "Zepeda-Velázquez C", "Dilworth D", "Hanley RP", "Gibson E", "Brown PJ", "Al-Awar R", "James LI", "Arrowsmith CH", "Barsyte-Lovejoy D", "Min J", "Vedadi M", "Schapira M", "Allali-Hassani A" ], "year": 2021, "year_values": [ 2021 ], "year_conflict": false, "journal": "Journal of medicinal chemistry", "doi": "10.1021/acs.jmedchem.0c01768", "pmid": 33522809, "url": "https://doi.org/10.1021/acs.jmedchem.0c01768", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "MRT837 and NSD2 PWWP1 small-molecule antagonists", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:33522809", "year": 2021, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1021/acs.jmedchem.0c01768" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6UE6", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [ { "name": "MR837 (3f)", "preparation_id": "PREP:MR837", "chemical_identity_status": "exact_single_CCD_identity", "assay_ids": [ "PWWP:ASSAY:0001", "PWWP:ASSAY:0002" ], "evidence_classes": [ "direct_binding_affinity" ], "domain_ids": [ "UP:O96028:PWWP1" ] } ], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1021/acs.jmedchem.0c01768", "kind": "publication", "kind_label": "Publication year", "date": "2021", "sort_date": "2021-00-00" }, { "id": "DOI:10.1038/s41467-021-25284-1", "reference_id": "REF:PDB:7OUF:primary", "reference_ids": [ "REF:PDB:7OUF:primary" ], "title": "Structural basis for the inhibition of HTLV-1 integration inferred from cryo-EM deltaretroviral intasome structures.", "authors": [ "Barski, M.S.", "Vanzo, T.", "Zhao, X.Z.", "Smith, S.J.", "Ballandras-Colas, A.", "Cronin, N.B.", "Pye, V.E.", "Hughes, S.H.", "Burke Jr., T.R.", "Cherepanov, P.", "Maertens, G.N." ], "year": 2021, "year_values": [ 2021 ], "year_conflict": false, "journal": "Nat Commun", "doi": "10.1038/s41467-021-25284-1", "pmid": 34404793, "url": "https://doi.org/10.1038/s41467-021-25284-1", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:7OUF:primary", "year": 2021, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1038/s41467-021-25284-1" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7OUF", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "7OUG", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "7OUH", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/s41467-021-25284-1", "kind": "publication", "kind_label": "Publication year", "date": "2021", "sort_date": "2021-00-00" }, { "id": "DOI:10.1038/s41586-020-03069-8", "reference_id": "REF:PDB:7CRO:primary", "reference_ids": [ "REF:PDB:7CRO:primary" ], "title": "Molecular basis of nucleosomal H3K36 methylation by NSD methyltransferases.", "authors": [ "Li, W.", "Tian, W.", "Yuan, G.", "Deng, P.", "Sengupta, D.", "Cheng, Z.", "Cao, Y.", "Ren, J.", "Qin, Y.", "Zhou, Y.", "Jia, Y.", "Gozani, O.", "Patel, D.J.", "Wang, Z." ], "year": 2021, "year_values": [ 2021 ], "year_conflict": false, "journal": "Nature", "doi": "10.1038/s41586-020-03069-8", "pmid": 33361816, "url": "https://doi.org/10.1038/s41586-020-03069-8", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:7CRO:primary", "year": 2021, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1038/s41586-020-03069-8" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7CRO", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "7CRP", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "7CRQ", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "7CRR", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/s41586-020-03069-8", "kind": "publication", "kind_label": "Publication year", "date": "2021", "sort_date": "2021-00-00" }, { "event_id": "PDB:6L87:release", "id": "6L87", "kind": "release", "kind_label": "PDB initial release", "date": "2021-01-06", "sort_date": "2021-01-06", "year": 2021, "title": "Solution structure of the tandem PWWP-ARID domains of human RBBP1", "url": "https://www.rcsb.org/structure/6L87", "proteins": [ { "protein_id": "UP:P29374", "uniprot": "P29374", "gene": "ARID4A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6L87", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P29374:PWWP1", "gene": "ARID4A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.jmb.2021.167224", "title": "Structural Insight into Chromatin Recognition by Multiple Domains of the Tumor Suppressor RBBP1.", "url": "https://doi.org/10.1016/j.jmb.2021.167224", "doi": "10.1016/j.jmb.2021.167224", "pmid": 34506790, "year": 2021 } ], "date_precision": "day", "source_date": "2021-01-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7LH9:deposition", "id": "7LH9", "kind": "deposition", "kind_label": "PDB deposition", "date": "2021-01-21", "sort_date": "2021-01-21", "year": 2021, "title": "Crystal structure of BRPF2 PWWP domain in complex with DNA", "url": "https://www.rcsb.org/structure/7LH9", "proteins": [ { "protein_id": "UP:O95696", "uniprot": "O95696", "gene": "BRD1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7LH9", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O95696:PWWP1", "gene": "BRD1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.bbagrm.2021.194688", "title": "Crystal structure of the BRPF2 PWWP domain in complex with DNA reveals a different binding mode than the HDGF family of PWWP domains.", "url": "https://doi.org/10.1016/j.bbagrm.2021.194688", "doi": "10.1016/j.bbagrm.2021.194688", "pmid": 33556623, "year": 2021 } ], "date_precision": "day", "source_date": "2021-01-21T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7E29:deposition", "id": "7E29", "kind": "deposition", "kind_label": "PDB deposition", "date": "2021-02-05", "sort_date": "2021-02-05", "year": 2021, "title": "Crystal Structure of Saccharomyces cerevisiae Ioc4 PWWP domain fused with MBP", "url": "https://www.rcsb.org/structure/7E29", "proteins": [ { "protein_id": "UP:Q04213", "uniprot": "Q04213", "gene": "IOC4", "organism": "Saccharomyces cerevisiae (strain ATCC 204508 / S288c)" } ], "structures": [ { "pdb_id": "7E29", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q04213:PWWP1", "gene": "IOC4", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkac077", "title": "H3K36 methylation and DNA-binding both promote Ioc4 recruitment and Isw1b remodeler function.", "url": "https://doi.org/10.1093/nar/gkac077", "doi": "10.1093/nar/gkac077", "pmid": 35188579, "year": 2022 } ], "date_precision": "day", "source_date": "2021-02-05T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7LMT:deposition", "id": "7LMT", "kind": "deposition", "kind_label": "PDB deposition", "date": "2021-02-05", "sort_date": "2021-02-05", "year": 2021, "title": "Histone-lysine N-methyltransferase NSD2-PWWP1 with compound MRT10241866a", "url": "https://www.rcsb.org/structure/7LMT", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7LMT", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:7LMT:primary", "title": "Histone-lysine N-methyltransferase NSD2-PWWP1 with compound MRT10241866a", "url": "https://www.rcsb.org/structure/7LMT", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2021-02-05T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7LH9:release", "id": "7LH9", "kind": "release", "kind_label": "PDB initial release", "date": "2021-02-17", "sort_date": "2021-02-17", "year": 2021, "title": "Crystal structure of BRPF2 PWWP domain in complex with DNA", "url": "https://www.rcsb.org/structure/7LH9", "proteins": [ { "protein_id": "UP:O95696", "uniprot": "O95696", "gene": "BRD1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7LH9", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O95696:PWWP1", "gene": "BRD1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.bbagrm.2021.194688", "title": "Crystal structure of the BRPF2 PWWP domain in complex with DNA reveals a different binding mode than the HDGF family of PWWP domains.", "url": "https://doi.org/10.1016/j.bbagrm.2021.194688", "doi": "10.1016/j.bbagrm.2021.194688", "pmid": 33556623, "year": 2021 } ], "date_precision": "day", "source_date": "2021-02-17T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7LMT:release", "id": "7LMT", "kind": "release", "kind_label": "PDB initial release", "date": "2021-03-10", "sort_date": "2021-03-10", "year": 2021, "title": "Histone-lysine N-methyltransferase NSD2-PWWP1 with compound MRT10241866a", "url": "https://www.rcsb.org/structure/7LMT", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7LMT", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:7LMT:primary", "title": "Histone-lysine N-methyltransferase NSD2-PWWP1 with compound MRT10241866a", "url": "https://www.rcsb.org/structure/7LMT", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2021-03-10T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7MDN:deposition", "id": "7MDN", "kind": "deposition", "kind_label": "PDB deposition", "date": "2021-04-05", "sort_date": "2021-04-05", "year": 2021, "title": "Histone-lysine N-methyltransferase NSD2-PWWP1 with compound MRT10241866a", "url": "https://www.rcsb.org/structure/7MDN", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7MDN", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-021-00898-0", "title": "A chemical probe targeting the PWWP domain alters NSD2 nucleolar localization.", "url": "https://doi.org/10.1038/s41589-021-00898-0", "doi": "10.1038/s41589-021-00898-0", "pmid": 34782742, "year": 2022 } ], "date_precision": "day", "source_date": "2021-04-05T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7MDN:release", "id": "7MDN", "kind": "release", "kind_label": "PDB initial release", "date": "2021-05-05", "sort_date": "2021-05-05", "year": 2021, "title": "Histone-lysine N-methyltransferase NSD2-PWWP1 with compound MRT10241866a", "url": "https://www.rcsb.org/structure/7MDN", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7MDN", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41589-021-00898-0", "title": "A chemical probe targeting the PWWP domain alters NSD2 nucleolar localization.", "url": "https://doi.org/10.1038/s41589-021-00898-0", "doi": "10.1038/s41589-021-00898-0", "pmid": 34782742, "year": 2022 } ], "date_precision": "day", "source_date": "2021-05-05T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7OUF:deposition", "id": "7OUF", "kind": "deposition", "kind_label": "PDB deposition", "date": "2021-06-11", "sort_date": "2021-06-11", "year": 2021, "title": "Structure of the STLV intasome:B56 complex bound to the strand-transfer inhibitor XZ450", "url": "https://www.rcsb.org/structure/7OUF", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7OUF", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-021-25284-1", "title": "Structural basis for the inhibition of HTLV-1 integration inferred from cryo-EM deltaretroviral intasome structures.", "url": "https://doi.org/10.1038/s41467-021-25284-1", "doi": "10.1038/s41467-021-25284-1", "pmid": 34404793, "year": 2021 } ], "date_precision": "day", "source_date": "2021-06-11T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:7OUG:deposition", "id": "7OUG", "kind": "deposition", "kind_label": "PDB deposition", "date": "2021-06-11", "sort_date": "2021-06-11", "year": 2021, "title": "STLV-1 intasome:B56 in complex with the strand-transfer inhibitor raltegravir", "url": "https://www.rcsb.org/structure/7OUG", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7OUG", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-021-25284-1", "title": "Structural basis for the inhibition of HTLV-1 integration inferred from cryo-EM deltaretroviral intasome structures.", "url": "https://doi.org/10.1038/s41467-021-25284-1", "doi": "10.1038/s41467-021-25284-1", "pmid": 34404793, "year": 2021 } ], "date_precision": "day", "source_date": "2021-06-11T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:7OUH:deposition", "id": "7OUH", "kind": "deposition", "kind_label": "PDB deposition", "date": "2021-06-11", "sort_date": "2021-06-11", "year": 2021, "title": "Structure of the STLV intasome:B56 complex bound to the strand-transfer inhibitor bictegravir", "url": "https://www.rcsb.org/structure/7OUH", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7OUH", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-021-25284-1", "title": "Structural basis for the inhibition of HTLV-1 integration inferred from cryo-EM deltaretroviral intasome structures.", "url": "https://doi.org/10.1038/s41467-021-25284-1", "doi": "10.1038/s41467-021-25284-1", "pmid": 34404793, "year": 2021 } ], "date_precision": "day", "source_date": "2021-06-11T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:7PEL:deposition", "id": "7PEL", "kind": "deposition", "kind_label": "PDB deposition", "date": "2021-08-10", "sort_date": "2021-08-10", "year": 2021, "title": "CryoEM structure of simian T-cell lymphotropic virus intasome in complex with PP2A regulatory subunit B56 gamma", "url": "https://www.rcsb.org/structure/7PEL", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7PEL", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-020-18874-y", "title": "Cryo-EM structure of the deltaretroviral intasome in complex with the PP2A regulatory subunit B56gamma.", "url": "https://doi.org/10.1038/s41467-020-18874-y", "doi": "10.1038/s41467-020-18874-y", "pmid": 33028863, "year": 2020 } ], "date_precision": "day", "source_date": "2021-08-10T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:7OUF:release", "id": "7OUF", "kind": "release", "kind_label": "PDB initial release", "date": "2021-08-18", "sort_date": "2021-08-18", "year": 2021, "title": "Structure of the STLV intasome:B56 complex bound to the strand-transfer inhibitor XZ450", "url": "https://www.rcsb.org/structure/7OUF", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7OUF", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-021-25284-1", "title": "Structural basis for the inhibition of HTLV-1 integration inferred from cryo-EM deltaretroviral intasome structures.", "url": "https://doi.org/10.1038/s41467-021-25284-1", "doi": "10.1038/s41467-021-25284-1", "pmid": 34404793, "year": 2021 } ], "date_precision": "day", "source_date": "2021-08-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:7OUG:release", "id": "7OUG", "kind": "release", "kind_label": "PDB initial release", "date": "2021-08-18", "sort_date": "2021-08-18", "year": 2021, "title": "STLV-1 intasome:B56 in complex with the strand-transfer inhibitor raltegravir", "url": "https://www.rcsb.org/structure/7OUG", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7OUG", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-021-25284-1", "title": "Structural basis for the inhibition of HTLV-1 integration inferred from cryo-EM deltaretroviral intasome structures.", "url": "https://doi.org/10.1038/s41467-021-25284-1", "doi": "10.1038/s41467-021-25284-1", "pmid": 34404793, "year": 2021 } ], "date_precision": "day", "source_date": "2021-08-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:7OUH:release", "id": "7OUH", "kind": "release", "kind_label": "PDB initial release", "date": "2021-08-18", "sort_date": "2021-08-18", "year": 2021, "title": "Structure of the STLV intasome:B56 complex bound to the strand-transfer inhibitor bictegravir", "url": "https://www.rcsb.org/structure/7OUH", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7OUH", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-021-25284-1", "title": "Structural basis for the inhibition of HTLV-1 integration inferred from cryo-EM deltaretroviral intasome structures.", "url": "https://doi.org/10.1038/s41467-021-25284-1", "doi": "10.1038/s41467-021-25284-1", "pmid": 34404793, "year": 2021 } ], "date_precision": "day", "source_date": "2021-08-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:7V8N:deposition", "id": "7V8N", "kind": "deposition", "kind_label": "PDB deposition", "date": "2021-08-23", "sort_date": "2021-08-23", "year": 2021, "title": "Crystal structure of the PWWP-ARID domain of ARID4A", "url": "https://www.rcsb.org/structure/7V8N", "proteins": [ { "protein_id": "UP:P29374", "uniprot": "P29374", "gene": "ARID4A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7V8N", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P29374:PWWP1", "gene": "ARID4A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.2210/pdb7v8n/pdb", "title": "Crystal structure of the PWWP-ARID of ARID4A", "url": "https://www.rcsb.org/structure/7V8N", "doi": "10.2210/pdb7V8N/pdb", "pmid": null, "year": 2022 }, { "id": "REF:PDB:7V8N:primary", "title": "Crystal structure of the PWWP-ARID of ARID4A", "url": "https://www.rcsb.org/structure/7V8N", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2021-08-23T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7PEL:release", "id": "7PEL", "kind": "release", "kind_label": "PDB initial release", "date": "2021-08-25", "sort_date": "2021-08-25", "year": 2021, "title": "CryoEM structure of simian T-cell lymphotropic virus intasome in complex with PP2A regulatory subunit B56 gamma", "url": "https://www.rcsb.org/structure/7PEL", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7PEL", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-020-18874-y", "title": "Cryo-EM structure of the deltaretroviral intasome in complex with the PP2A regulatory subunit B56gamma.", "url": "https://doi.org/10.1038/s41467-020-18874-y", "doi": "10.1038/s41467-020-18874-y", "pmid": 33028863, "year": 2020 } ], "date_precision": "day", "source_date": "2021-08-25T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:7VLN:deposition", "id": "7VLN", "kind": "deposition", "kind_label": "PDB deposition", "date": "2021-10-05", "sort_date": "2021-10-05", "year": 2021, "title": "NSD2-PWWP1 domain bound with an imidazol-5-yl benzonitrile compound", "url": "https://www.rcsb.org/structure/7VLN", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7VLN", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acs.jmedchem.2c00709", "title": "Structure-Based Discovery of a Series of NSD2-PWWP1 Inhibitors.", "url": "https://doi.org/10.1021/acs.jmedchem.2c00709", "doi": "10.1021/acs.jmedchem.2c00709", "pmid": 35704853, "year": 2022 } ], "date_precision": "day", "source_date": "2021-10-05T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1016/j.ejmech.2022.114528", "reference_id": "PMID:35717870", "reference_ids": [ "PMID:35717870" ], "title": "Discovery of a potent and selective proteolysis targeting chimera (PROTAC) degrader of NSD3 histone methyltransferase.", "authors": [ "Sun Y", "Zhang Y", "Chen X", "Yu A", "Du W", "Huang Y", "Wu F", "Yu L", "Li J", "Wen C", "Yang H", "Shi Q", "Geng M", "Huang X", "Xu S" ], "year": 2022, "year_values": [ 2022 ], "year_conflict": false, "journal": "European journal of medicinal chemistry", "doi": "10.1016/j.ejmech.2022.114528", "pmid": 35717870, "url": "https://doi.org/10.1016/j.ejmech.2022.114528", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "NSD3-targeted PROTAC development; literature-only future-work context", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:35717870", "year": 2022, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.ejmech.2022.114528" } ], "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.ejmech.2022.114528", "kind": "publication", "kind_label": "Publication year", "date": "2022", "sort_date": "2022-00-00" }, { "id": "DOI:10.1021/acs.jmedchem.2c00709", "reference_id": "PMID:35704853", "reference_ids": [ "PMID:35704853" ], "title": "Structure-Based Discovery of a Series of NSD2-PWWP1 Inhibitors.", "authors": [ "Li N", "Yang H", "Liu K", "Zhou L", "Huang Y", "Cao D", "Li Y", "Sun Y", "Yu A", "Du Z", "Yu F", "Zhang Y", "Wang B", "Geng M", "Li J", "Xiong B", "Xu S", "Huang X", "Liu T" ], "year": 2022, "year_values": [ 2022 ], "year_conflict": false, "journal": "Journal of medicinal chemistry", "doi": "10.1021/acs.jmedchem.2c00709", "pmid": 35704853, "url": "https://doi.org/10.1021/acs.jmedchem.2c00709", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Structure-based NSD2 PWWP1 inhibitor series", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:35704853", "year": 2022, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1021/acs.jmedchem.2c00709" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7VLN", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1021/acs.jmedchem.2c00709", "kind": "publication", "kind_label": "Publication year", "date": "2022", "sort_date": "2022-00-00" }, { "id": "DOI:10.1021/acs.jmedchem.2c00807", "reference_id": "PMID:35895319", "reference_ids": [ "PMID:35895319" ], "title": "Discovery of a First-in-Class Degrader for Nuclear Receptor Binding SET Domain Protein 2 (NSD2) and Ikaros/Aiolos.", "authors": [ "Meng F", "Xu C", "Park KS", "Kaniskan HÜ", "Wang GG", "Jin J" ], "year": 2022, "year_values": [ 2022 ], "year_conflict": false, "journal": "Journal of medicinal chemistry", "doi": "10.1021/acs.jmedchem.2c00807", "pmid": 35895319, "url": "https://doi.org/10.1021/acs.jmedchem.2c00807", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "NSD2 and Ikaros/Aiolos degrader development", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:35895319", "year": 2022, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1021/acs.jmedchem.2c00807" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1021/acs.jmedchem.2c00807", "kind": "publication", "kind_label": "Publication year", "date": "2022", "sort_date": "2022-00-00" }, { "id": "DOI:10.1038/s41589-021-00898-0", "reference_id": "PMID:34782742", "reference_ids": [ "PMID:34782742" ], "title": "A chemical probe targeting the PWWP domain alters NSD2 nucleolar localization.", "authors": [ "Dilworth D", "Hanley RP", "Ferreira de Freitas R", "Allali-Hassani A", "Zhou M", "Mehta N", "Marunde MR", "Ackloo S", "Carvalho Machado RA", "Khalili Yazdi A", "Owens DDG", "Vu V", "Nie DY", "Alqazzaz M", "Marcon E", "Li F", "Chau I", "Bolotokova A", "Qin S", "Lei M", "Liu Y", "Szewczyk MM", "Dong A", "Kazemzadeh S", "Abramyan T", "Popova IK", "Hall NW", "Meiners MJ", "Cheek MA", "Gibson E", "Kireev D", "Greenblatt JF", "Keogh MC", "Min J", "Brown PJ", "Vedadi M", "Arrowsmith CH", "Barsyte-Lovejoy D", "James LI", "Schapira M" ], "year": 2022, "year_values": [ 2022 ], "year_conflict": false, "journal": "Nature chemical biology", "doi": "10.1038/s41589-021-00898-0", "pmid": 34782742, "url": "https://doi.org/10.1038/s41589-021-00898-0", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "UNC6934 chemical probe and UNC7145 negative control", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:34782742", "year": 2022, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1038/s41589-021-00898-0" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "6XCG", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7MDN", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [ { "name": "MRT866", "preparation_id": "PREP:MRT866", "chemical_identity_status": "exact_single_CCD_identity", "assay_ids": [ "PWWP:ASSAY:0003" ], "evidence_classes": [ "direct_binding_affinity" ], "domain_ids": [ "UP:O96028:PWWP1" ] }, { "name": "UNC6934", "preparation_id": "PREP:UNC6934", "chemical_identity_status": "exact_single_CCD_identity", "assay_ids": [ "PWWP:ASSAY:0004", "PWWP:ASSAY:0005", "PWWP:ASSAY:0006" ], "evidence_classes": [ "biochemical_interaction_inhibition", "cellular_interaction_response", "direct_binding_affinity" ], "domain_ids": [ "UP:O96028:PWWP1" ] }, { "name": "UNC7145", "preparation_id": "PREP:UNC7145", "chemical_identity_status": "paper_label_exact_identity_unresolved", "assay_ids": [ "PWWP:ASSAY:0007" ], "evidence_classes": [ "negative_binding_test" ], "domain_ids": [ "UP:O96028:PWWP1" ] } ], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/s41589-021-00898-0", "kind": "publication", "kind_label": "Publication year", "date": "2022", "sort_date": "2022-00-00" }, { "id": "DOI:10.1093/nar/gkac077", "reference_id": "REF:PDB:7E29:primary", "reference_ids": [ "REF:PDB:7E29:primary" ], "title": "H3K36 methylation and DNA-binding both promote Ioc4 recruitment and Isw1b remodeler function.", "authors": [ "Li, J.", "Bergmann, L.", "Rafael de Almeida, A.", "Webb, K.M.", "Gogol, M.M.", "Voigt, P.", "Liu, Y.", "Liang, H.", "Smolle, M.M." ], "year": 2022, "year_values": [ 2022 ], "year_conflict": false, "journal": "Nucleic Acids Res.", "doi": "10.1093/nar/gkac077", "pmid": 35188579, "url": "https://doi.org/10.1093/nar/gkac077", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:7E29:primary", "year": 2022, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1093/nar/gkac077" } ], "proteins": [ { "protein_id": "UP:Q04213", "uniprot": "Q04213", "gene": "IOC4", "organism": "Saccharomyces cerevisiae (strain ATCC 204508 / S288c)" } ], "structures": [ { "pdb_id": "7E29", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1093/nar/gkac077", "kind": "publication", "kind_label": "Publication year", "date": "2022", "sort_date": "2022-00-00" }, { "event_id": "PDB:7E29:release", "id": "7E29", "kind": "release", "kind_label": "PDB initial release", "date": "2022-02-09", "sort_date": "2022-02-09", "year": 2022, "title": "Crystal Structure of Saccharomyces cerevisiae Ioc4 PWWP domain fused with MBP", "url": "https://www.rcsb.org/structure/7E29", "proteins": [ { "protein_id": "UP:Q04213", "uniprot": "Q04213", "gene": "IOC4", "organism": "Saccharomyces cerevisiae (strain ATCC 204508 / S288c)" } ], "structures": [ { "pdb_id": "7E29", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q04213:PWWP1", "gene": "IOC4", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkac077", "title": "H3K36 methylation and DNA-binding both promote Ioc4 recruitment and Isw1b remodeler function.", "url": "https://doi.org/10.1093/nar/gkac077", "doi": "10.1093/nar/gkac077", "pmid": 35188579, "year": 2022 } ], "date_precision": "day", "source_date": "2022-02-09T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7VLN:release", "id": "7VLN", "kind": "release", "kind_label": "PDB initial release", "date": "2022-07-06", "sort_date": "2022-07-06", "year": 2022, "title": "NSD2-PWWP1 domain bound with an imidazol-5-yl benzonitrile compound", "url": "https://www.rcsb.org/structure/7VLN", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7VLN", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acs.jmedchem.2c00709", "title": "Structure-Based Discovery of a Series of NSD2-PWWP1 Inhibitors.", "url": "https://doi.org/10.1021/acs.jmedchem.2c00709", "doi": "10.1021/acs.jmedchem.2c00709", "pmid": 35704853, "year": 2022 } ], "date_precision": "day", "source_date": "2022-07-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8AG6:deposition", "id": "8AG6", "kind": "deposition", "kind_label": "PDB deposition", "date": "2022-07-19", "sort_date": "2022-07-19", "year": 2022, "title": "human MutSalpha (MSH2/MSH6) binding to DNA with a GT mismatch", "url": "https://www.rcsb.org/structure/8AG6", "proteins": [ { "protein_id": "UP:P52701", "uniprot": "P52701", "gene": "MSH6", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8AG6", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad015", "title": "Unexpected moves: a conformational change in MutS alpha enables high-affinity DNA mismatch binding.", "url": "https://doi.org/10.1093/nar/gkad015", "doi": "10.1093/nar/gkad015", "pmid": 36715327, "year": 2023 } ], "date_precision": "day", "source_date": "2022-07-19T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:7V8N:release", "id": "7V8N", "kind": "release", "kind_label": "PDB initial release", "date": "2022-08-31", "sort_date": "2022-08-31", "year": 2022, "title": "Crystal structure of the PWWP-ARID domain of ARID4A", "url": "https://www.rcsb.org/structure/7V8N", "proteins": [ { "protein_id": "UP:P29374", "uniprot": "P29374", "gene": "ARID4A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7V8N", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:P29374:PWWP1", "gene": "ARID4A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.2210/pdb7v8n/pdb", "title": "Crystal structure of the PWWP-ARID of ARID4A", "url": "https://www.rcsb.org/structure/7V8N", "doi": "10.2210/pdb7V8N/pdb", "pmid": null, "year": 2022 }, { "id": "REF:PDB:7V8N:primary", "title": "Crystal structure of the PWWP-ARID of ARID4A", "url": "https://www.rcsb.org/structure/7V8N", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2022-08-31T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8EIH:deposition", "id": "8EIH", "kind": "deposition", "kind_label": "PDB deposition", "date": "2022-09-15", "sort_date": "2022-09-15", "year": 2022, "title": "Cryo-EM structure of human DNMT3B homo-tetramer (form I)", "url": "https://www.rcsb.org/structure/8EIH", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8EIH", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad972", "title": "Structural basis for the allosteric regulation and dynamic assembly of DNMT3B.", "url": "https://doi.org/10.1093/nar/gkad972", "doi": "10.1093/nar/gkad972", "pmid": 37941146, "year": 2023 } ], "date_precision": "day", "source_date": "2022-09-15T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8EII:deposition", "id": "8EII", "kind": "deposition", "kind_label": "PDB deposition", "date": "2022-09-15", "sort_date": "2022-09-15", "year": 2022, "title": "Cryo-EM structure of human DNMT3B homo-tetramer (form II)", "url": "https://www.rcsb.org/structure/8EII", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8EII", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad972", "title": "Structural basis for the allosteric regulation and dynamic assembly of DNMT3B.", "url": "https://doi.org/10.1093/nar/gkad972", "doi": "10.1093/nar/gkad972", "pmid": 37941146, "year": 2023 } ], "date_precision": "day", "source_date": "2022-09-15T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:8EIJ:deposition", "id": "8EIJ", "kind": "deposition", "kind_label": "PDB deposition", "date": "2022-09-15", "sort_date": "2022-09-15", "year": 2022, "title": "Cryo-EM structure of human DNMT3B homo-trimer", "url": "https://www.rcsb.org/structure/8EIJ", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8EIJ", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad972", "title": "Structural basis for the allosteric regulation and dynamic assembly of DNMT3B.", "url": "https://doi.org/10.1093/nar/gkad972", "doi": "10.1093/nar/gkad972", "pmid": 37941146, "year": 2023 } ], "date_precision": "day", "source_date": "2022-09-15T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:8EIK:deposition", "id": "8EIK", "kind": "deposition", "kind_label": "PDB deposition", "date": "2022-09-15", "sort_date": "2022-09-15", "year": 2022, "title": "Cryo-EM structure of human DNMT3B homo-hexamer", "url": "https://www.rcsb.org/structure/8EIK", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8EIK", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad972", "title": "Structural basis for the allosteric regulation and dynamic assembly of DNMT3B.", "url": "https://doi.org/10.1093/nar/gkad972", "doi": "10.1093/nar/gkad972", "pmid": 37941146, "year": 2023 } ], "date_precision": "day", "source_date": "2022-09-15T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "id": "DOI:10.1021/jacs.3c01421", "reference_id": "PMID:36976643", "reference_ids": [ "PMID:36976643" ], "title": "Discovery of a Potent and Selective Targeted NSD2 Degrader for the Reduction of H3K36me2.", "authors": [ "Hanley RP", "Nie DY", "Tabor JR", "Li F", "Sobh A", "Xu C", "Barker NK", "Dilworth D", "Hajian T", "Gibson E", "Szewczyk MM", "Brown PJ", "Barsyte-Lovejoy D", "Herring LE", "Wang GG", "Licht JD", "Vedadi M", "Arrowsmith CH", "James LI" ], "year": 2023, "year_values": [ 2023 ], "year_conflict": false, "journal": "Journal of the American Chemical Society", "doi": "10.1021/jacs.3c01421", "pmid": 36976643, "url": "https://doi.org/10.1021/jacs.3c01421", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "NSD2 degrader targeting H3K36me2 reduction", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:36976643", "year": 2023, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1021/jacs.3c01421" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1021/jacs.3c01421", "kind": "publication", "kind_label": "Publication year", "date": "2023", "sort_date": "2023-00-00" }, { "id": "DOI:10.1093/nar/gkad015", "reference_id": "REF:PDB:8AG6:primary", "reference_ids": [ "REF:PDB:8AG6:primary" ], "title": "Unexpected moves: a conformational change in MutS alpha enables high-affinity DNA mismatch binding.", "authors": [ "Bruekner, S.R.", "Pieters, W.", "Fish, A.", "Liaci, A.M.", "Scheffers, S.", "Rayner, E.", "Kaldenbach, D.", "Drost, L.", "Dekker, M.", "van Hees-Stuivenberg, S.", "Delzenne-Goette, E.", "de Konink, C.", "Houlleberghs, H.", "Dubbink, H.J.", "AlSaegh, A.", "de Wind, N.", "Forster, F.", "Te Riele, H.", "Sixma, T.K." ], "year": 2023, "year_values": [ 2023 ], "year_conflict": false, "journal": "Nucleic Acids Res.", "doi": "10.1093/nar/gkad015", "pmid": 36715327, "url": "https://doi.org/10.1093/nar/gkad015", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:8AG6:primary", "year": 2023, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1093/nar/gkad015" } ], "proteins": [ { "protein_id": "UP:P52701", "uniprot": "P52701", "gene": "MSH6", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8AG6", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1093/nar/gkad015", "kind": "publication", "kind_label": "Publication year", "date": "2023", "sort_date": "2023-00-00" }, { "id": "DOI:10.1093/nar/gkad674", "reference_id": "PMID:37615563", "reference_ids": [ "PMID:37615563" ], "title": "Multivalency of nucleosome recognition by LEDGF.", "authors": [ "Koutná E", "Lux V", "Kouba T", "Škerlová J", "Nováček J", "Srb P", "Hexnerová R", "Šváchová H", "Kukačka Z", "Novák P", "Fábry M", "Poepsel S", "Veverka V" ], "year": 2023, "year_values": [ 2023 ], "year_conflict": false, "journal": "Nucleic acids research", "doi": "10.1093/nar/gkad674", "pmid": 37615563, "url": "https://doi.org/10.1093/nar/gkad674", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Multivalent LEDGF nucleosome recognition", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:37615563", "year": 2023, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1093/nar/gkad674" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8CBN", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "8CBQ", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "8PC5", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "8PC6", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "8PEO", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "8PEP", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1093/nar/gkad674", "kind": "publication", "kind_label": "Publication year", "date": "2023", "sort_date": "2023-00-00" }, { "id": "DOI:10.1093/nar/gkad972", "reference_id": "REF:PDB:8EIH:primary", "reference_ids": [ "REF:PDB:8EIH:primary" ], "title": "Structural basis for the allosteric regulation and dynamic assembly of DNMT3B.", "authors": [ "Lu, J.", "Fang, J.", "Zhu, H.", "Liang, K.L.", "Khudaverdyan, N.", "Song, J." ], "year": 2023, "year_values": [ 2023 ], "year_conflict": false, "journal": "Nucleic Acids Res.", "doi": "10.1093/nar/gkad972", "pmid": 37941146, "url": "https://doi.org/10.1093/nar/gkad972", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:8EIH:primary", "year": 2023, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1093/nar/gkad972" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8EIH", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "8EII", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "8EIJ", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "8EIK", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1093/nar/gkad972", "kind": "publication", "kind_label": "Publication year", "date": "2023", "sort_date": "2023-00-00" }, { "event_id": "PDB:8CBN:deposition", "id": "8CBN", "kind": "deposition", "kind_label": "PDB deposition", "date": "2023-01-25", "sort_date": "2023-01-25", "year": 2023, "title": "structure of LEDGF/p75 PWWP domain bound to the H3K36 trimethylated dinucleosome", "url": "https://www.rcsb.org/structure/8CBN", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8CBN", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad674", "title": "Multivalency of nucleosome recognition by LEDGF.", "url": "https://doi.org/10.1093/nar/gkad674", "doi": "10.1093/nar/gkad674", "pmid": 37615563, "year": 2023 } ], "date_precision": "day", "source_date": "2023-01-25T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8CBQ:deposition", "id": "8CBQ", "kind": "deposition", "kind_label": "PDB deposition", "date": "2023-01-25", "sort_date": "2023-01-25", "year": 2023, "title": "structure of LEDGF/p75 PWWP domain bound to the H3K36 trimethylated dinucleosome", "url": "https://www.rcsb.org/structure/8CBQ", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8CBQ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad674", "title": "Multivalency of nucleosome recognition by LEDGF.", "url": "https://doi.org/10.1093/nar/gkad674", "doi": "10.1093/nar/gkad674", "pmid": 37615563, "year": 2023 } ], "date_precision": "day", "source_date": "2023-01-25T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8AG6:release", "id": "8AG6", "kind": "release", "kind_label": "PDB initial release", "date": "2023-01-25", "sort_date": "2023-01-25", "year": 2023, "title": "human MutSalpha (MSH2/MSH6) binding to DNA with a GT mismatch", "url": "https://www.rcsb.org/structure/8AG6", "proteins": [ { "protein_id": "UP:P52701", "uniprot": "P52701", "gene": "MSH6", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8AG6", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad015", "title": "Unexpected moves: a conformational change in MutS alpha enables high-affinity DNA mismatch binding.", "url": "https://doi.org/10.1093/nar/gkad015", "doi": "10.1093/nar/gkad015", "pmid": 36715327, "year": 2023 } ], "date_precision": "day", "source_date": "2023-01-25T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:8PC5:deposition", "id": "8PC5", "kind": "deposition", "kind_label": "PDB deposition", "date": "2023-06-09", "sort_date": "2023-06-09", "year": 2023, "title": "H3K36me3 nucleosome-LEDGF/p75 PWWP domain complex", "url": "https://www.rcsb.org/structure/8PC5", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8PC5", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad674", "title": "Multivalency of nucleosome recognition by LEDGF.", "url": "https://doi.org/10.1093/nar/gkad674", "doi": "10.1093/nar/gkad674", "pmid": 37615563, "year": 2023 } ], "date_precision": "day", "source_date": "2023-06-09T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8PC6:deposition", "id": "8PC6", "kind": "deposition", "kind_label": "PDB deposition", "date": "2023-06-09", "sort_date": "2023-06-09", "year": 2023, "title": "H3K36me3 nucleosome-LEDGF/p75 PWWP domain complex - pose 2", "url": "https://www.rcsb.org/structure/8PC6", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8PC6", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad674", "title": "Multivalency of nucleosome recognition by LEDGF.", "url": "https://doi.org/10.1093/nar/gkad674", "doi": "10.1093/nar/gkad674", "pmid": 37615563, "year": 2023 } ], "date_precision": "day", "source_date": "2023-06-09T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8PEO:deposition", "id": "8PEO", "kind": "deposition", "kind_label": "PDB deposition", "date": "2023-06-14", "sort_date": "2023-06-14", "year": 2023, "title": "H3K36me2 nucleosome-LEDGF/p75 PWWP domain complex", "url": "https://www.rcsb.org/structure/8PEO", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8PEO", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad674", "title": "Multivalency of nucleosome recognition by LEDGF.", "url": "https://doi.org/10.1093/nar/gkad674", "doi": "10.1093/nar/gkad674", "pmid": 37615563, "year": 2023 } ], "date_precision": "day", "source_date": "2023-06-14T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8PEP:deposition", "id": "8PEP", "kind": "deposition", "kind_label": "PDB deposition", "date": "2023-06-14", "sort_date": "2023-06-14", "year": 2023, "title": "H3K36me2 nucleosome-LEDGF/p75 PWWP domain complex - pose 2", "url": "https://www.rcsb.org/structure/8PEP", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8PEP", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad674", "title": "Multivalency of nucleosome recognition by LEDGF.", "url": "https://doi.org/10.1093/nar/gkad674", "doi": "10.1093/nar/gkad674", "pmid": 37615563, "year": 2023 } ], "date_precision": "day", "source_date": "2023-06-14T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8PC5:release", "id": "8PC5", "kind": "release", "kind_label": "PDB initial release", "date": "2023-08-16", "sort_date": "2023-08-16", "year": 2023, "title": "H3K36me3 nucleosome-LEDGF/p75 PWWP domain complex", "url": "https://www.rcsb.org/structure/8PC5", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8PC5", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad674", "title": "Multivalency of nucleosome recognition by LEDGF.", "url": "https://doi.org/10.1093/nar/gkad674", "doi": "10.1093/nar/gkad674", "pmid": 37615563, "year": 2023 } ], "date_precision": "day", "source_date": "2023-08-16T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8PC6:release", "id": "8PC6", "kind": "release", "kind_label": "PDB initial release", "date": "2023-08-16", "sort_date": "2023-08-16", "year": 2023, "title": "H3K36me3 nucleosome-LEDGF/p75 PWWP domain complex - pose 2", "url": "https://www.rcsb.org/structure/8PC6", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8PC6", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad674", "title": "Multivalency of nucleosome recognition by LEDGF.", "url": "https://doi.org/10.1093/nar/gkad674", "doi": "10.1093/nar/gkad674", "pmid": 37615563, "year": 2023 } ], "date_precision": "day", "source_date": "2023-08-16T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8PEO:release", "id": "8PEO", "kind": "release", "kind_label": "PDB initial release", "date": "2023-08-16", "sort_date": "2023-08-16", "year": 2023, "title": "H3K36me2 nucleosome-LEDGF/p75 PWWP domain complex", "url": "https://www.rcsb.org/structure/8PEO", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8PEO", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad674", "title": "Multivalency of nucleosome recognition by LEDGF.", "url": "https://doi.org/10.1093/nar/gkad674", "doi": "10.1093/nar/gkad674", "pmid": 37615563, "year": 2023 } ], "date_precision": "day", "source_date": "2023-08-16T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8PEP:release", "id": "8PEP", "kind": "release", "kind_label": "PDB initial release", "date": "2023-08-16", "sort_date": "2023-08-16", "year": 2023, "title": "H3K36me2 nucleosome-LEDGF/p75 PWWP domain complex - pose 2", "url": "https://www.rcsb.org/structure/8PEP", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8PEP", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad674", "title": "Multivalency of nucleosome recognition by LEDGF.", "url": "https://doi.org/10.1093/nar/gkad674", "doi": "10.1093/nar/gkad674", "pmid": 37615563, "year": 2023 } ], "date_precision": "day", "source_date": "2023-08-16T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8CBQ:release", "id": "8CBQ", "kind": "release", "kind_label": "PDB initial release", "date": "2023-09-06", "sort_date": "2023-09-06", "year": 2023, "title": "structure of LEDGF/p75 PWWP domain bound to the H3K36 trimethylated dinucleosome", "url": "https://www.rcsb.org/structure/8CBQ", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8CBQ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad674", "title": "Multivalency of nucleosome recognition by LEDGF.", "url": "https://doi.org/10.1093/nar/gkad674", "doi": "10.1093/nar/gkad674", "pmid": 37615563, "year": 2023 } ], "date_precision": "day", "source_date": "2023-09-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8EIH:release", "id": "8EIH", "kind": "release", "kind_label": "PDB initial release", "date": "2023-09-20", "sort_date": "2023-09-20", "year": 2023, "title": "Cryo-EM structure of human DNMT3B homo-tetramer (form I)", "url": "https://www.rcsb.org/structure/8EIH", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8EIH", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad972", "title": "Structural basis for the allosteric regulation and dynamic assembly of DNMT3B.", "url": "https://doi.org/10.1093/nar/gkad972", "doi": "10.1093/nar/gkad972", "pmid": 37941146, "year": 2023 } ], "date_precision": "day", "source_date": "2023-09-20T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8EII:release", "id": "8EII", "kind": "release", "kind_label": "PDB initial release", "date": "2023-09-20", "sort_date": "2023-09-20", "year": 2023, "title": "Cryo-EM structure of human DNMT3B homo-tetramer (form II)", "url": "https://www.rcsb.org/structure/8EII", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8EII", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad972", "title": "Structural basis for the allosteric regulation and dynamic assembly of DNMT3B.", "url": "https://doi.org/10.1093/nar/gkad972", "doi": "10.1093/nar/gkad972", "pmid": 37941146, "year": 2023 } ], "date_precision": "day", "source_date": "2023-09-20T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:8EIJ:release", "id": "8EIJ", "kind": "release", "kind_label": "PDB initial release", "date": "2023-09-20", "sort_date": "2023-09-20", "year": 2023, "title": "Cryo-EM structure of human DNMT3B homo-trimer", "url": "https://www.rcsb.org/structure/8EIJ", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8EIJ", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad972", "title": "Structural basis for the allosteric regulation and dynamic assembly of DNMT3B.", "url": "https://doi.org/10.1093/nar/gkad972", "doi": "10.1093/nar/gkad972", "pmid": 37941146, "year": 2023 } ], "date_precision": "day", "source_date": "2023-09-20T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:8EIK:release", "id": "8EIK", "kind": "release", "kind_label": "PDB initial release", "date": "2023-09-20", "sort_date": "2023-09-20", "year": 2023, "title": "Cryo-EM structure of human DNMT3B homo-hexamer", "url": "https://www.rcsb.org/structure/8EIK", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8EIK", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad972", "title": "Structural basis for the allosteric regulation and dynamic assembly of DNMT3B.", "url": "https://doi.org/10.1093/nar/gkad972", "doi": "10.1093/nar/gkad972", "pmid": 37941146, "year": 2023 } ], "date_precision": "day", "source_date": "2023-09-20T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:8QZM:deposition", "id": "8QZM", "kind": "deposition", "kind_label": "PDB deposition", "date": "2023-10-27", "sort_date": "2023-10-27", "year": 2023, "title": "Structure of DNMT3A1 UDR region bound to H2AK119ub nucleosome", "url": "https://www.rcsb.org/structure/8QZM", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8QZM", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s44319-024-00306-3", "title": "The N-terminal region of DNMT3A engages the nucleosome surface to aid chromatin recruitment.", "url": "https://doi.org/10.1038/s44319-024-00306-3", "doi": "10.1038/s44319-024-00306-3", "pmid": 39528729, "year": 2024 } ], "date_precision": "day", "source_date": "2023-10-27T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:8CBN:release", "id": "8CBN", "kind": "release", "kind_label": "PDB initial release", "date": "2023-12-27", "sort_date": "2023-12-27", "year": 2023, "title": "structure of LEDGF/p75 PWWP domain bound to the H3K36 trimethylated dinucleosome", "url": "https://www.rcsb.org/structure/8CBN", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8CBN", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkad674", "title": "Multivalency of nucleosome recognition by LEDGF.", "url": "https://doi.org/10.1093/nar/gkad674", "doi": "10.1093/nar/gkad674", "pmid": 37615563, "year": 2023 } ], "date_precision": "day", "source_date": "2023-12-27T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1002/1873-3468.14981", "reference_id": "PMID:39031937", "reference_ids": [ "PMID:39031937" ], "title": "Fragment-based discovery of small molecule inhibitors of the HDGFRP2 PWWP domain.", "authors": [ "Wei X", "Li S", "Li Z", "Wang L", "Fan W", "Ruan K", "Gao J" ], "year": 2024, "year_values": [ 2024 ], "year_conflict": false, "journal": "FEBS letters", "doi": "10.1002/1873-3468.14981", "pmid": 39031937, "url": "https://doi.org/10.1002/1873-3468.14981", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Varenicline and BPP fragment ligands of HDGFL2 PWWP", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:39031937", "year": 2024, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1002/1873-3468.14981" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" }, { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8Z6C", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "8Z6O", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" }, { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" }, { "domain_id": "UP:Q9Y3E1:PWWP1", "gene": "HDGFL3", "domain_name": "PWWP1" } ], "ligands": [ { "name": "BPP", "preparation_id": "PREP:BPP", "chemical_identity_status": "exact_single_CCD_identity", "assay_ids": [ "PWWP:ASSAY:0011", "PWWP:ASSAY:0012", "PWWP:ASSAY:0013" ], "evidence_classes": [ "direct_binding_affinity" ], "domain_ids": [ "UP:O75475:PWWP1", "UP:Q7Z4V5:PWWP1", "UP:Q9Y3E1:PWWP1" ] }, { "name": "varenicline", "preparation_id": "PREP:VARENICLINE", "chemical_identity_status": "exact_single_CCD_identity", "assay_ids": [ "PWWP:ASSAY:0010" ], "evidence_classes": [ "direct_binding_affinity" ], "domain_ids": [ "UP:Q7Z4V5:PWWP1" ] } ], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1002/1873-3468.14981", "kind": "publication", "kind_label": "Publication year", "date": "2024", "sort_date": "2024-00-00" }, { "id": "DOI:10.1016/j.ejmech.2024.116960", "reference_id": "PMID:39461037", "reference_ids": [ "PMID:39461037" ], "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "authors": [ "Vantieghem T", "Aslam NA", "Osipov EM", "Akele M", "Van Belle S", "Beelen S", "Drexler M", "Paulovcakova T", "Lux V", "Fearon D", "Douangamath A", "von Delft F", "Christ F", "Veverka V", "Verwilst P", "Van Aerschot A", "Debyser Z", "Strelkov SV" ], "year": 2024, "year_values": [ 2024 ], "year_conflict": false, "journal": "European journal of medicinal chemistry", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "68-fragment HRP-family crystallographic screen and rational fragment expansion", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:39461037", "year": 2024, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.ejmech.2024.116960" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" }, { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG0", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HG1", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HG2", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HG3", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HG4", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HG5", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HG6", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HG7", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HG8", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HG9", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGA", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGB", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGC", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGD", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGE", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGF", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGG", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGH", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGI", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGJ", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGK", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGL", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGM", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGN", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGO", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGP", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGQ", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGR", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGS", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGT", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGU", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGV", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGW", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGX", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGY", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HGZ", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH0", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH1", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH2", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH3", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH4", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH5", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH6", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH7", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH8", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HH9", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHA", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHB", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHC", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHD", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHE", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHF", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHG", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHH", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHI", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHJ", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHK", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHL", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHM", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHN", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHO", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHP", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHQ", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "7HHR", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9G91", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9G94", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9G96", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9GRS", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9GRT", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9GRU", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9GRV", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.ejmech.2024.116960", "kind": "publication", "kind_label": "Publication year", "date": "2024", "sort_date": "2024-00-00" }, { "id": "DOI:10.1016/j.ejmech.2024.116965", "reference_id": "PMID:39413441", "reference_ids": [ "PMID:39413441" ], "title": "Inhibitors targeting the PWWP domain-containing proteins.", "authors": [ "Huang Y", "Li B", "Wu Z", "Liu K", "Min J" ], "year": 2024, "year_values": [ 2024 ], "year_conflict": false, "journal": "European journal of medicinal chemistry", "doi": "10.1016/j.ejmech.2024.116965", "pmid": 39413441, "url": "https://doi.org/10.1016/j.ejmech.2024.116965", "source_type": "review", "citation_role": "pwwp_research_context", "citation_role_label": "Review / synthesis", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP inhibitor discovery review for citation chaining only", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:39413441", "year": 2024, "source_type": "review", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.ejmech.2024.116965" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" }, { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" }, { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.ejmech.2024.116965", "kind": "publication", "kind_label": "Publication year", "date": "2024", "sort_date": "2024-00-00" }, { "id": "DOI:10.1021/acs.jmedchem.3c01765", "reference_id": "PMID:38687638", "reference_ids": [ "PMID:38687638" ], "title": "Discovery of LLC0424 as a Potent and Selective in Vivo NSD2 PROTAC Degrader.", "authors": [ "Liu L", "Parolia A", "Liu Y", "Hou C", "He T", "Qiao Y", "Eyunni S", "Luo J", "Li C", "Wang Y", "Zhou F", "Huang W", "Ren X", "Wang Z", "Chinnaiyan AM", "Ding K" ], "year": 2024, "year_values": [ 2024 ], "year_conflict": false, "journal": "Journal of medicinal chemistry", "doi": "10.1021/acs.jmedchem.3c01765", "pmid": 38687638, "url": "https://doi.org/10.1021/acs.jmedchem.3c01765", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "LLC0424 NSD2 PROTAC", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "source_records": [ { "reference_id": "PMID:38687638", "year": 2024, "source_type": "primary_experimental_research", "verification_level": "full_text_retrieved_metadata_verified_claims_pending", "url": "https://doi.org/10.1021/acs.jmedchem.3c01765" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1021/acs.jmedchem.3c01765", "kind": "publication", "kind_label": "Publication year", "date": "2024", "sort_date": "2024-00-00" }, { "id": "DOI:10.1021/acs.jmedchem.4c00215", "reference_id": "REF:PDB:9EXW:primary", "reference_ids": [ "REF:PDB:9EXW:primary" ], "title": "Identification of Novel Potent NSD2-PWWP1 Ligands Using Structure-Based Design and Computational Approaches.", "authors": [ "Carlino, L.", "Astles, P.C.", "Ackroyd, B.", "Ahmed, A.", "Chan, C.", "Collie, G.W.", "Dale, I.L.", "O'Donovan, D.H.", "Fawcett, C.", "di Fruscia, P.", "Gohlke, A.", "Guo, X.", "Hao-Ru Hsu, J.", "Kaplan, B.", "Milbradt, A.G.", "Northall, S.", "Petrovic, D.", "Rivers, E.L.", "Underwood, E.", "Webb, A." ], "year": 2024, "year_values": [ 2024 ], "year_conflict": false, "journal": "J.Med.Chem.", "doi": "10.1021/acs.jmedchem.4c00215", "pmid": 38748070, "url": "https://doi.org/10.1021/acs.jmedchem.4c00215", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:9EXW:primary", "year": 2024, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1021/acs.jmedchem.4c00215" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9EXW", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9EXX", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9EXY", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1021/acs.jmedchem.4c00215", "kind": "publication", "kind_label": "Publication year", "date": "2024", "sort_date": "2024-00-00" }, { "id": "DOI:10.1038/s44319-024-00306-3", "reference_id": "REF:PDB:8QZM:primary", "reference_ids": [ "REF:PDB:8QZM:primary" ], "title": "The N-terminal region of DNMT3A engages the nucleosome surface to aid chromatin recruitment.", "authors": [ "Wapenaar, H.", "Clifford, G.", "Rolls, W.", "Pasquier, M.", "Burdett, H.", "Zhang, Y.", "Deak, G.", "Zou, J.", "Spanos, C.", "Taylor, M.R.D.", "Mills, J.", "Watson, J.A.", "Kumar, D.", "Clark, R.", "Das, A.", "Valsakumar, D.", "Bramham, J.", "Voigt, P.", "Sproul, D.", "Wilson, M.D." ], "year": 2024, "year_values": [ 2024 ], "year_conflict": false, "journal": "Embo Rep.", "doi": "10.1038/s44319-024-00306-3", "pmid": 39528729, "url": "https://doi.org/10.1038/s44319-024-00306-3", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:8QZM:primary", "year": 2024, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1038/s44319-024-00306-3" } ], "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8QZM", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/s44319-024-00306-3", "kind": "publication", "kind_label": "Publication year", "date": "2024", "sort_date": "2024-00-00" }, { "event_id": "PDB:9EXW:deposition", "id": "9EXW", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-04-09", "sort_date": "2024-04-09", "year": 2024, "title": "Crystal structure of the PWWP1 domain of NSD2 bound by compound 17.", "url": "https://www.rcsb.org/structure/9EXW", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9EXW", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acs.jmedchem.4c00215", "title": "Identification of Novel Potent NSD2-PWWP1 Ligands Using Structure-Based Design and Computational Approaches.", "url": "https://doi.org/10.1021/acs.jmedchem.4c00215", "doi": "10.1021/acs.jmedchem.4c00215", "pmid": 38748070, "year": 2024 } ], "date_precision": "day", "source_date": "2024-04-09T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9EXX:deposition", "id": "9EXX", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-04-09", "sort_date": "2024-04-09", "year": 2024, "title": "Crystal structure of the PWWP1 domain of NSD2 bound by compound 18.", "url": "https://www.rcsb.org/structure/9EXX", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9EXX", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acs.jmedchem.4c00215", "title": "Identification of Novel Potent NSD2-PWWP1 Ligands Using Structure-Based Design and Computational Approaches.", "url": "https://doi.org/10.1021/acs.jmedchem.4c00215", "doi": "10.1021/acs.jmedchem.4c00215", "pmid": 38748070, "year": 2024 } ], "date_precision": "day", "source_date": "2024-04-09T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9EXY:deposition", "id": "9EXY", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-04-09", "sort_date": "2024-04-09", "year": 2024, "title": "Crystal structure of the PWWP1 domain of NSD2 bound by compound 34.", "url": "https://www.rcsb.org/structure/9EXY", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9EXY", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acs.jmedchem.4c00215", "title": "Identification of Novel Potent NSD2-PWWP1 Ligands Using Structure-Based Design and Computational Approaches.", "url": "https://doi.org/10.1021/acs.jmedchem.4c00215", "doi": "10.1021/acs.jmedchem.4c00215", "pmid": 38748070, "year": 2024 } ], "date_precision": "day", "source_date": "2024-04-09T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8Z6C:deposition", "id": "8Z6C", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-04-19", "sort_date": "2024-04-19", "year": 2024, "title": "Crystal structure of HDGFRP2 PWWP domain in complex with 4-(4-bromo-1H-pyrazol-3-yl) pyridine", "url": "https://www.rcsb.org/structure/8Z6C", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8Z6C", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1002/1873-3468.14981", "title": "Fragment-based discovery of small molecule inhibitors of the HDGFRP2 PWWP domain.", "url": "https://doi.org/10.1002/1873-3468.14981", "doi": "10.1002/1873-3468.14981", "pmid": 39031937, "year": 2024 } ], "date_precision": "day", "source_date": "2024-04-19T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8Z6O:deposition", "id": "8Z6O", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-04-19", "sort_date": "2024-04-19", "year": 2024, "title": "Crystal structure of HDGFRP2 PWWP domain in complex with Varenicline", "url": "https://www.rcsb.org/structure/8Z6O", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8Z6O", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1002/1873-3468.14981", "title": "Fragment-based discovery of small molecule inhibitors of the HDGFRP2 PWWP domain.", "url": "https://doi.org/10.1002/1873-3468.14981", "doi": "10.1002/1873-3468.14981", "pmid": 39031937, "year": 2024 } ], "date_precision": "day", "source_date": "2024-04-19T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8ZLK:deposition", "id": "8ZLK", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-05-20", "sort_date": "2024-05-20", "year": 2024, "title": "PWWP domain from human DNMT3B", "url": "https://www.rcsb.org/structure/8ZLK", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8ZLK", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1126/sciadv.adu8116", "title": "Histone modification-driven structural remodeling unleashes DNMT3B in DNA methylation.", "url": "https://doi.org/10.1126/sciadv.adu8116", "doi": "10.1126/sciadv.adu8116", "pmid": 40138405, "year": 2025 } ], "date_precision": "day", "source_date": "2024-05-20T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9EXW:release", "id": "9EXW", "kind": "release", "kind_label": "PDB initial release", "date": "2024-05-29", "sort_date": "2024-05-29", "year": 2024, "title": "Crystal structure of the PWWP1 domain of NSD2 bound by compound 17.", "url": "https://www.rcsb.org/structure/9EXW", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9EXW", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acs.jmedchem.4c00215", "title": "Identification of Novel Potent NSD2-PWWP1 Ligands Using Structure-Based Design and Computational Approaches.", "url": "https://doi.org/10.1021/acs.jmedchem.4c00215", "doi": "10.1021/acs.jmedchem.4c00215", "pmid": 38748070, "year": 2024 } ], "date_precision": "day", "source_date": "2024-05-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9EXX:release", "id": "9EXX", "kind": "release", "kind_label": "PDB initial release", "date": "2024-05-29", "sort_date": "2024-05-29", "year": 2024, "title": "Crystal structure of the PWWP1 domain of NSD2 bound by compound 18.", "url": "https://www.rcsb.org/structure/9EXX", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9EXX", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acs.jmedchem.4c00215", "title": "Identification of Novel Potent NSD2-PWWP1 Ligands Using Structure-Based Design and Computational Approaches.", "url": "https://doi.org/10.1021/acs.jmedchem.4c00215", "doi": "10.1021/acs.jmedchem.4c00215", "pmid": 38748070, "year": 2024 } ], "date_precision": "day", "source_date": "2024-05-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9EXY:release", "id": "9EXY", "kind": "release", "kind_label": "PDB initial release", "date": "2024-05-29", "sort_date": "2024-05-29", "year": 2024, "title": "Crystal structure of the PWWP1 domain of NSD2 bound by compound 34.", "url": "https://www.rcsb.org/structure/9EXY", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9EXY", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acs.jmedchem.4c00215", "title": "Identification of Novel Potent NSD2-PWWP1 Ligands Using Structure-Based Design and Computational Approaches.", "url": "https://doi.org/10.1021/acs.jmedchem.4c00215", "doi": "10.1021/acs.jmedchem.4c00215", "pmid": 38748070, "year": 2024 } ], "date_precision": "day", "source_date": "2024-05-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9FOC:deposition", "id": "9FOC", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-06-11", "sort_date": "2024-06-11", "year": 2024, "title": "Crystal structure of the PWWP1 domain of NSD2 bound by compound 11.", "url": "https://www.rcsb.org/structure/9FOC", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9FOC", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acsmedchemlett.5c00396", "title": "Structural and Molecular Insight into the PWWP1 Domain of NSD2 from the Discovery of Novel Binders Via DNA-Encoded Library Screening.", "url": "https://doi.org/10.1021/acsmedchemlett.5c00396", "doi": "10.1021/acsmedchemlett.5c00396", "pmid": 40959233, "year": 2025 } ], "date_precision": "day", "source_date": "2024-06-11T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9FOE:deposition", "id": "9FOE", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-06-11", "sort_date": "2024-06-11", "year": 2024, "title": "Crystal structure of the PWWP1 domain of NSD2 bound by compound 7.", "url": "https://www.rcsb.org/structure/9FOE", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9FOE", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acsmedchemlett.5c00396", "title": "Structural and Molecular Insight into the PWWP1 Domain of NSD2 from the Discovery of Novel Binders Via DNA-Encoded Library Screening.", "url": "https://doi.org/10.1021/acsmedchemlett.5c00396", "doi": "10.1021/acsmedchemlett.5c00396", "pmid": 40959233, "year": 2025 } ], "date_precision": "day", "source_date": "2024-06-11T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9G91:deposition", "id": "9G91", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-07-24", "sort_date": "2024-07-24", "year": 2024, "title": "Crystal structure of HRP-2 PWWP domain in complex with compound 43", "url": "https://www.rcsb.org/structure/9G91", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9G91", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-07-24T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9G94:deposition", "id": "9G94", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-07-24", "sort_date": "2024-07-24", "year": 2024, "title": "Crystal structure of HRP-2 PWWP domain in complex with compound 32", "url": "https://www.rcsb.org/structure/9G94", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9G94", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-07-24T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9G96:deposition", "id": "9G96", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-07-24", "sort_date": "2024-07-24", "year": 2024, "title": "Crystal structure of HRP-2 PWWP domain in complex with compound 42", "url": "https://www.rcsb.org/structure/9G96", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9G96", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-07-24T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HG0:deposition", "id": "7HG0", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z46169212", "url": "https://www.rcsb.org/structure/7HG0", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG0", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HG1:deposition", "id": "7HG1", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1079512010", "url": "https://www.rcsb.org/structure/7HG1", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG1", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HG2:deposition", "id": "7HG2", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1401276297", "url": "https://www.rcsb.org/structure/7HG2", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG2", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HG3:deposition", "id": "7HG3", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z319891284", "url": "https://www.rcsb.org/structure/7HG3", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG3", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HG4:deposition", "id": "7HG4", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1696844792", "url": "https://www.rcsb.org/structure/7HG4", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG4", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HG5:deposition", "id": "7HG5", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z2142244288", "url": "https://www.rcsb.org/structure/7HG5", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG5", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HG6:deposition", "id": "7HG6", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z839706072", "url": "https://www.rcsb.org/structure/7HG6", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG6", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HG7:deposition", "id": "7HG7", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z46169164", "url": "https://www.rcsb.org/structure/7HG7", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG7", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HG8:deposition", "id": "7HG8", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z445856640", "url": "https://www.rcsb.org/structure/7HG8", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG8", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HG9:deposition", "id": "7HG9", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z131516158", "url": "https://www.rcsb.org/structure/7HG9", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG9", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGA:deposition", "id": "7HGA", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1980894300", "url": "https://www.rcsb.org/structure/7HGA", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGA", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGB:deposition", "id": "7HGB", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z33297786", "url": "https://www.rcsb.org/structure/7HGB", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGB", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGC:deposition", "id": "7HGC", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1428159350", "url": "https://www.rcsb.org/structure/7HGC", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGC", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGD:deposition", "id": "7HGD", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z363071686", "url": "https://www.rcsb.org/structure/7HGD", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGD", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGE:deposition", "id": "7HGE", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z45527714", "url": "https://www.rcsb.org/structure/7HGE", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGE", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGF:deposition", "id": "7HGF", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1262433643", "url": "https://www.rcsb.org/structure/7HGF", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGF", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGG:deposition", "id": "7HGG", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z422396686", "url": "https://www.rcsb.org/structure/7HGG", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGG", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGH:deposition", "id": "7HGH", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z26823525", "url": "https://www.rcsb.org/structure/7HGH", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGH", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGI:deposition", "id": "7HGI", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z57475068", "url": "https://www.rcsb.org/structure/7HGI", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGI", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGJ:deposition", "id": "7HGJ", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z751811134", "url": "https://www.rcsb.org/structure/7HGJ", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGJ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGK:deposition", "id": "7HGK", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z31721798", "url": "https://www.rcsb.org/structure/7HGK", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGK", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGL:deposition", "id": "7HGL", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z137790394", "url": "https://www.rcsb.org/structure/7HGL", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGL", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGM:deposition", "id": "7HGM", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z438067480", "url": "https://www.rcsb.org/structure/7HGM", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGM", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGN:deposition", "id": "7HGN", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z54226006", "url": "https://www.rcsb.org/structure/7HGN", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGN", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGO:deposition", "id": "7HGO", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z431807512", "url": "https://www.rcsb.org/structure/7HGO", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGO", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGP:deposition", "id": "7HGP", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z19735067", "url": "https://www.rcsb.org/structure/7HGP", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGP", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGQ:deposition", "id": "7HGQ", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z94597856", "url": "https://www.rcsb.org/structure/7HGQ", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGQ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGR:deposition", "id": "7HGR", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z104924088", "url": "https://www.rcsb.org/structure/7HGR", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGR", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGS:deposition", "id": "7HGS", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z355202286", "url": "https://www.rcsb.org/structure/7HGS", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGS", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGT:deposition", "id": "7HGT", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z354992234", "url": "https://www.rcsb.org/structure/7HGT", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGT", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGU:deposition", "id": "7HGU", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z216450634", "url": "https://www.rcsb.org/structure/7HGU", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGU", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGV:deposition", "id": "7HGV", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z103740620", "url": "https://www.rcsb.org/structure/7HGV", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGV", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGW:deposition", "id": "7HGW", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1407673036", "url": "https://www.rcsb.org/structure/7HGW", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGW", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGX:deposition", "id": "7HGX", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1362754425", "url": "https://www.rcsb.org/structure/7HGX", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGX", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGY:deposition", "id": "7HGY", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z285782452", "url": "https://www.rcsb.org/structure/7HGY", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGY", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGZ:deposition", "id": "7HGZ", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1509882419", "url": "https://www.rcsb.org/structure/7HGZ", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGZ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH0:deposition", "id": "7HH0", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z57390007", "url": "https://www.rcsb.org/structure/7HH0", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH0", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH1:deposition", "id": "7HH1", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z53825177", "url": "https://www.rcsb.org/structure/7HH1", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH1", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH2:deposition", "id": "7HH2", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1238477757", "url": "https://www.rcsb.org/structure/7HH2", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH2", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH3:deposition", "id": "7HH3", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1245580425", "url": "https://www.rcsb.org/structure/7HH3", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH3", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH4:deposition", "id": "7HH4", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1139246057", "url": "https://www.rcsb.org/structure/7HH4", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH4", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH5:deposition", "id": "7HH5", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z168883358", "url": "https://www.rcsb.org/structure/7HH5", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH5", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH6:deposition", "id": "7HH6", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z54633859", "url": "https://www.rcsb.org/structure/7HH6", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH6", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH7:deposition", "id": "7HH7", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1003207278", "url": "https://www.rcsb.org/structure/7HH7", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH7", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH8:deposition", "id": "7HH8", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1258992717", "url": "https://www.rcsb.org/structure/7HH8", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH8", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH9:deposition", "id": "7HH9", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1250132788", "url": "https://www.rcsb.org/structure/7HH9", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH9", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHA:deposition", "id": "7HHA", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z53825020", "url": "https://www.rcsb.org/structure/7HHA", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHA", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHB:deposition", "id": "7HHB", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1263529721", "url": "https://www.rcsb.org/structure/7HHB", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHB", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHC:deposition", "id": "7HHC", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z31432964", "url": "https://www.rcsb.org/structure/7HHC", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHC", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHD:deposition", "id": "7HHD", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z90526999", "url": "https://www.rcsb.org/structure/7HHD", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHD", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHE:deposition", "id": "7HHE", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1203252645", "url": "https://www.rcsb.org/structure/7HHE", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHE", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHF:deposition", "id": "7HHF", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1267773633", "url": "https://www.rcsb.org/structure/7HHF", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHF", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHG:deposition", "id": "7HHG", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1741966151", "url": "https://www.rcsb.org/structure/7HHG", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHG", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHH:deposition", "id": "7HHH", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1259335862", "url": "https://www.rcsb.org/structure/7HHH", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHH", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHI:deposition", "id": "7HHI", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z805551440", "url": "https://www.rcsb.org/structure/7HHI", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHI", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHJ:deposition", "id": "7HHJ", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z100642432", "url": "https://www.rcsb.org/structure/7HHJ", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHJ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHK:deposition", "id": "7HHK", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1247413608", "url": "https://www.rcsb.org/structure/7HHK", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHK", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHL:deposition", "id": "7HHL", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1262327517", "url": "https://www.rcsb.org/structure/7HHL", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHL", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHM:deposition", "id": "7HHM", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z234898257", "url": "https://www.rcsb.org/structure/7HHM", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHM", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHN:deposition", "id": "7HHN", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z133632670", "url": "https://www.rcsb.org/structure/7HHN", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHN", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHO:deposition", "id": "7HHO", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z235361315", "url": "https://www.rcsb.org/structure/7HHO", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHO", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHP:deposition", "id": "7HHP", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z31723394", "url": "https://www.rcsb.org/structure/7HHP", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHP", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHQ:deposition", "id": "7HHQ", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1741815708", "url": "https://www.rcsb.org/structure/7HHQ", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHQ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHR:deposition", "id": "7HHR", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-08-29", "sort_date": "2024-08-29", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z57744712", "url": "https://www.rcsb.org/structure/7HHR", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHR", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-08-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9GRS:deposition", "id": "9GRS", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-09-12", "sort_date": "2024-09-12", "year": 2024, "title": "Crystal structure of HRP-2 PWWP domain in complex with compound 8", "url": "https://www.rcsb.org/structure/9GRS", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9GRS", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-09-12T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9GRT:deposition", "id": "9GRT", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-09-12", "sort_date": "2024-09-12", "year": 2024, "title": "Crystal structure of HRP-2 PWWP domain in complex with compound 29", "url": "https://www.rcsb.org/structure/9GRT", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9GRT", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-09-12T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9GRU:deposition", "id": "9GRU", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-09-12", "sort_date": "2024-09-12", "year": 2024, "title": "Crystal structure of HRP-2 PWWP domain in complex with compound 30", "url": "https://www.rcsb.org/structure/9GRU", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9GRU", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-09-12T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9GRV:deposition", "id": "9GRV", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-09-12", "sort_date": "2024-09-12", "year": 2024, "title": "Crystal structure of HRP-2 PWWP domain in complex with compound 37", "url": "https://www.rcsb.org/structure/9GRV", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9GRV", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-09-12T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9E00:deposition", "id": "9E00", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-10-17", "sort_date": "2024-10-17", "year": 2024, "title": "Cryo-EM structure of human DNMT3A2-DNMT3B3 complex bound to di-nucleosome", "url": "https://www.rcsb.org/structure/9E00", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E00", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2024-10-17T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:9E05:deposition", "id": "9E05", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-10-17", "sort_date": "2024-10-17", "year": 2024, "title": "The consensus model of the cryo-EM structure of human DNMT3A2-DNMT3B3 complex bound to di-nucleosome", "url": "https://www.rcsb.org/structure/9E05", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E05", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2024-10-17T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9E0F:deposition", "id": "9E0F", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-10-17", "sort_date": "2024-10-17", "year": 2024, "title": "A focus of DNMT tetramer (1) of the cryo-EM structure of human DNMT3A2-DNMT3B3 complex bound to di-nucleosome", "url": "https://www.rcsb.org/structure/9E0F", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E0F", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2024-10-17T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9E0G:deposition", "id": "9E0G", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-10-17", "sort_date": "2024-10-17", "year": 2024, "title": "A focus of tetramer (2) of the cryo-EM structure of human DNMT3A2-DNMT3B3 complex bound to di-nucleosome", "url": "https://www.rcsb.org/structure/9E0G", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E0G", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2024-10-17T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9E2D:deposition", "id": "9E2D", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-10-22", "sort_date": "2024-10-22", "year": 2024, "title": "Cryo-EM structure of human DNMT3A2-DNMT3B3 complex bound to a di-nucleosome with a five base pair linker", "url": "https://www.rcsb.org/structure/9E2D", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E2D", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2024-10-22T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9E2Q:deposition", "id": "9E2Q", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-10-22", "sort_date": "2024-10-22", "year": 2024, "title": "Cryo-EM structure of DNMT 3A2/3B3 tetramer in complex with a di-nucleosome with a six base pair linker", "url": "https://www.rcsb.org/structure/9E2Q", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E2Q", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2024-10-22T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:9E2R:deposition", "id": "9E2R", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-10-22", "sort_date": "2024-10-22", "year": 2024, "title": "Cryo-EM structure of human DNMT3A2-DNMT3B3 complex bound to a di-nucleosome and an histone-3 peptide", "url": "https://www.rcsb.org/structure/9E2R", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E2R", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2024-10-22T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9E3D:deposition", "id": "9E3D", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-10-23", "sort_date": "2024-10-23", "year": 2024, "title": "Cryo-EM structure of DNMT 3A2/3B3 tetramer in complex with a di-nucleosome with K120R mutant H2B", "url": "https://www.rcsb.org/structure/9E3D", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E3D", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2024-10-23T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9E3R:deposition", "id": "9E3R", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-10-23", "sort_date": "2024-10-23", "year": 2024, "title": "Cryo-EM structure of PWWP domain deleted DNMT 3A2/3B3 in complex with a di-nucleosome", "url": "https://www.rcsb.org/structure/9E3R", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E3R", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2024-10-23T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:8QZM:release", "id": "8QZM", "kind": "release", "kind_label": "PDB initial release", "date": "2024-10-23", "sort_date": "2024-10-23", "year": 2024, "title": "Structure of DNMT3A1 UDR region bound to H2AK119ub nucleosome", "url": "https://www.rcsb.org/structure/8QZM", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8QZM", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s44319-024-00306-3", "title": "The N-terminal region of DNMT3A engages the nucleosome surface to aid chromatin recruitment.", "url": "https://doi.org/10.1038/s44319-024-00306-3", "doi": "10.1038/s44319-024-00306-3", "pmid": 39528729, "year": 2024 } ], "date_precision": "day", "source_date": "2024-10-23T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:9E3U:deposition", "id": "9E3U", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-10-24", "sort_date": "2024-10-24", "year": 2024, "title": "Cryo-EM structure of DNMT 3A2/3B3 tetramer bound to a di-nucleosome with a 25 base-pair linker", "url": "https://www.rcsb.org/structure/9E3U", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E3U", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "REF:PDB:9E3U:primary", "title": "The structural basis for de novo DNA methylation in chromatin", "url": "https://www.rcsb.org/structure/9E3U", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2024-10-24T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:7HG0:release", "id": "7HG0", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z46169212", "url": "https://www.rcsb.org/structure/7HG0", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG0", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HG1:release", "id": "7HG1", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1079512010", "url": "https://www.rcsb.org/structure/7HG1", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG1", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HG2:release", "id": "7HG2", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1401276297", "url": "https://www.rcsb.org/structure/7HG2", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG2", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HG3:release", "id": "7HG3", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z319891284", "url": "https://www.rcsb.org/structure/7HG3", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG3", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HG4:release", "id": "7HG4", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1696844792", "url": "https://www.rcsb.org/structure/7HG4", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG4", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HG5:release", "id": "7HG5", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z2142244288", "url": "https://www.rcsb.org/structure/7HG5", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG5", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HG6:release", "id": "7HG6", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z839706072", "url": "https://www.rcsb.org/structure/7HG6", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG6", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HG7:release", "id": "7HG7", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z46169164", "url": "https://www.rcsb.org/structure/7HG7", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG7", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HG8:release", "id": "7HG8", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z445856640", "url": "https://www.rcsb.org/structure/7HG8", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG8", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HG9:release", "id": "7HG9", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z131516158", "url": "https://www.rcsb.org/structure/7HG9", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HG9", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGA:release", "id": "7HGA", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1980894300", "url": "https://www.rcsb.org/structure/7HGA", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGA", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGB:release", "id": "7HGB", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z33297786", "url": "https://www.rcsb.org/structure/7HGB", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGB", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGC:release", "id": "7HGC", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1428159350", "url": "https://www.rcsb.org/structure/7HGC", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGC", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGD:release", "id": "7HGD", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z363071686", "url": "https://www.rcsb.org/structure/7HGD", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGD", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGE:release", "id": "7HGE", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z45527714", "url": "https://www.rcsb.org/structure/7HGE", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGE", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGF:release", "id": "7HGF", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1262433643", "url": "https://www.rcsb.org/structure/7HGF", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGF", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGG:release", "id": "7HGG", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z422396686", "url": "https://www.rcsb.org/structure/7HGG", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGG", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGH:release", "id": "7HGH", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z26823525", "url": "https://www.rcsb.org/structure/7HGH", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGH", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGI:release", "id": "7HGI", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z57475068", "url": "https://www.rcsb.org/structure/7HGI", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGI", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGJ:release", "id": "7HGJ", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z751811134", "url": "https://www.rcsb.org/structure/7HGJ", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGJ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGK:release", "id": "7HGK", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z31721798", "url": "https://www.rcsb.org/structure/7HGK", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGK", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGL:release", "id": "7HGL", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z137790394", "url": "https://www.rcsb.org/structure/7HGL", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGL", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGM:release", "id": "7HGM", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z438067480", "url": "https://www.rcsb.org/structure/7HGM", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGM", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGN:release", "id": "7HGN", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z54226006", "url": "https://www.rcsb.org/structure/7HGN", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGN", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGO:release", "id": "7HGO", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z431807512", "url": "https://www.rcsb.org/structure/7HGO", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGO", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGP:release", "id": "7HGP", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z19735067", "url": "https://www.rcsb.org/structure/7HGP", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGP", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGQ:release", "id": "7HGQ", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z94597856", "url": "https://www.rcsb.org/structure/7HGQ", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGQ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGR:release", "id": "7HGR", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z104924088", "url": "https://www.rcsb.org/structure/7HGR", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGR", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGS:release", "id": "7HGS", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z355202286", "url": "https://www.rcsb.org/structure/7HGS", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGS", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGT:release", "id": "7HGT", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z354992234", "url": "https://www.rcsb.org/structure/7HGT", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGT", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGU:release", "id": "7HGU", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z216450634", "url": "https://www.rcsb.org/structure/7HGU", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGU", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGV:release", "id": "7HGV", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z103740620", "url": "https://www.rcsb.org/structure/7HGV", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGV", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGW:release", "id": "7HGW", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1407673036", "url": "https://www.rcsb.org/structure/7HGW", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGW", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGX:release", "id": "7HGX", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1362754425", "url": "https://www.rcsb.org/structure/7HGX", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGX", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGY:release", "id": "7HGY", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z285782452", "url": "https://www.rcsb.org/structure/7HGY", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGY", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HGZ:release", "id": "7HGZ", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1509882419", "url": "https://www.rcsb.org/structure/7HGZ", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HGZ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH0:release", "id": "7HH0", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z57390007", "url": "https://www.rcsb.org/structure/7HH0", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH0", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH1:release", "id": "7HH1", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z53825177", "url": "https://www.rcsb.org/structure/7HH1", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH1", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH2:release", "id": "7HH2", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1238477757", "url": "https://www.rcsb.org/structure/7HH2", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH2", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH3:release", "id": "7HH3", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1245580425", "url": "https://www.rcsb.org/structure/7HH3", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH3", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH4:release", "id": "7HH4", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1139246057", "url": "https://www.rcsb.org/structure/7HH4", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH4", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH5:release", "id": "7HH5", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z168883358", "url": "https://www.rcsb.org/structure/7HH5", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH5", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH6:release", "id": "7HH6", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z54633859", "url": "https://www.rcsb.org/structure/7HH6", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH6", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH7:release", "id": "7HH7", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1003207278", "url": "https://www.rcsb.org/structure/7HH7", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH7", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH8:release", "id": "7HH8", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1258992717", "url": "https://www.rcsb.org/structure/7HH8", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH8", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HH9:release", "id": "7HH9", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1250132788", "url": "https://www.rcsb.org/structure/7HH9", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HH9", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHA:release", "id": "7HHA", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z53825020", "url": "https://www.rcsb.org/structure/7HHA", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHA", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHB:release", "id": "7HHB", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1263529721", "url": "https://www.rcsb.org/structure/7HHB", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHB", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHC:release", "id": "7HHC", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z31432964", "url": "https://www.rcsb.org/structure/7HHC", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHC", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHD:release", "id": "7HHD", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z90526999", "url": "https://www.rcsb.org/structure/7HHD", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHD", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHE:release", "id": "7HHE", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1203252645", "url": "https://www.rcsb.org/structure/7HHE", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHE", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHF:release", "id": "7HHF", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1267773633", "url": "https://www.rcsb.org/structure/7HHF", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHF", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHG:release", "id": "7HHG", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1741966151", "url": "https://www.rcsb.org/structure/7HHG", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHG", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHH:release", "id": "7HHH", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1259335862", "url": "https://www.rcsb.org/structure/7HHH", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHH", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHI:release", "id": "7HHI", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z805551440", "url": "https://www.rcsb.org/structure/7HHI", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHI", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHJ:release", "id": "7HHJ", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z100642432", "url": "https://www.rcsb.org/structure/7HHJ", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHJ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHK:release", "id": "7HHK", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1247413608", "url": "https://www.rcsb.org/structure/7HHK", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHK", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHL:release", "id": "7HHL", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1262327517", "url": "https://www.rcsb.org/structure/7HHL", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHL", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHM:release", "id": "7HHM", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z234898257", "url": "https://www.rcsb.org/structure/7HHM", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHM", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHN:release", "id": "7HHN", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z133632670", "url": "https://www.rcsb.org/structure/7HHN", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHN", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHO:release", "id": "7HHO", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z235361315", "url": "https://www.rcsb.org/structure/7HHO", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHO", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHP:release", "id": "7HHP", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z31723394", "url": "https://www.rcsb.org/structure/7HHP", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHP", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHQ:release", "id": "7HHQ", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1741815708", "url": "https://www.rcsb.org/structure/7HHQ", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHQ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:7HHR:release", "id": "7HHR", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z57744712", "url": "https://www.rcsb.org/structure/7HHR", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "7HHR", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9G91:release", "id": "9G91", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "Crystal structure of HRP-2 PWWP domain in complex with compound 43", "url": "https://www.rcsb.org/structure/9G91", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9G91", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9G94:release", "id": "9G94", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "Crystal structure of HRP-2 PWWP domain in complex with compound 32", "url": "https://www.rcsb.org/structure/9G94", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9G94", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9G96:release", "id": "9G96", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "Crystal structure of HRP-2 PWWP domain in complex with compound 42", "url": "https://www.rcsb.org/structure/9G96", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9G96", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9GRS:release", "id": "9GRS", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "Crystal structure of HRP-2 PWWP domain in complex with compound 8", "url": "https://www.rcsb.org/structure/9GRS", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9GRS", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9GRT:release", "id": "9GRT", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "Crystal structure of HRP-2 PWWP domain in complex with compound 29", "url": "https://www.rcsb.org/structure/9GRT", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9GRT", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9GRU:release", "id": "9GRU", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "Crystal structure of HRP-2 PWWP domain in complex with compound 30", "url": "https://www.rcsb.org/structure/9GRU", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9GRU", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9GRV:release", "id": "9GRV", "kind": "release", "kind_label": "PDB initial release", "date": "2024-11-06", "sort_date": "2024-11-06", "year": 2024, "title": "Crystal structure of HRP-2 PWWP domain in complex with compound 37", "url": "https://www.rcsb.org/structure/9GRV", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9GRV", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.ejmech.2024.116960", "title": "Rational fragment-based design of compounds targeting the PWWP domain of the HRP family.", "url": "https://doi.org/10.1016/j.ejmech.2024.116960", "doi": "10.1016/j.ejmech.2024.116960", "pmid": 39461037, "year": 2024 } ], "date_precision": "day", "source_date": "2024-11-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9KN9:deposition", "id": "9KN9", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-11-18", "sort_date": "2024-11-18", "year": 2024, "title": "NSD2-PWWP1 domain bound with compound 1.", "url": "https://www.rcsb.org/structure/9KN9", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9KN9", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acs.jmedchem.5c01902", "title": "Fragment-Based Screening of NSD2-PWWP1 Identifies Novel Covalent Allosteric Ligands That Diminish Methyllysine and DNA Binding Abilities of NSD2.", "url": "https://doi.org/10.1021/acs.jmedchem.5c01902", "doi": "10.1021/acs.jmedchem.5c01902", "pmid": 41264880, "year": 2025 } ], "date_precision": "day", "source_date": "2024-11-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9KNA:deposition", "id": "9KNA", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-11-18", "sort_date": "2024-11-18", "year": 2024, "title": "NSD2-PWWP1 domain bound with compound 6", "url": "https://www.rcsb.org/structure/9KNA", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9KNA", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acs.jmedchem.5c01902", "title": "Fragment-Based Screening of NSD2-PWWP1 Identifies Novel Covalent Allosteric Ligands That Diminish Methyllysine and DNA Binding Abilities of NSD2.", "url": "https://doi.org/10.1021/acs.jmedchem.5c01902", "doi": "10.1021/acs.jmedchem.5c01902", "pmid": 41264880, "year": 2025 } ], "date_precision": "day", "source_date": "2024-11-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9KNB:deposition", "id": "9KNB", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-11-18", "sort_date": "2024-11-18", "year": 2024, "title": "NSD2-PWWP1 domain bound with compound 9", "url": "https://www.rcsb.org/structure/9KNB", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9KNB", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acs.jmedchem.5c01902", "title": "Fragment-Based Screening of NSD2-PWWP1 Identifies Novel Covalent Allosteric Ligands That Diminish Methyllysine and DNA Binding Abilities of NSD2.", "url": "https://doi.org/10.1021/acs.jmedchem.5c01902", "doi": "10.1021/acs.jmedchem.5c01902", "pmid": 41264880, "year": 2025 } ], "date_precision": "day", "source_date": "2024-11-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9MP0:deposition", "id": "9MP0", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-12-29", "sort_date": "2024-12-29", "year": 2024, "title": "The cryo-EM structure of the human DNA methyltransferases DNMT3A2 and DNMT3L dodecamer", "url": "https://www.rcsb.org/structure/9MP0", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9MP0", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41594-025-01704-4", "title": "Mechanisms of DNMT3A-3L-mediated de novo DNA methylation on chromatin.", "url": "https://doi.org/10.1038/s41594-025-01704-4", "doi": "10.1038/s41594-025-01704-4", "pmid": 41174279, "year": 2026 } ], "date_precision": "day", "source_date": "2024-12-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:9MPO:deposition", "id": "9MPO", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-12-31", "sort_date": "2024-12-31", "year": 2024, "title": "The cryo-EM structure of the human DNA methyltransferase DNMT3A2 and DNMT3L octamer", "url": "https://www.rcsb.org/structure/9MPO", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9MPO", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41594-025-01704-4", "title": "Mechanisms of DNMT3A-3L-mediated de novo DNA methylation on chromatin.", "url": "https://doi.org/10.1038/s41594-025-01704-4", "doi": "10.1038/s41594-025-01704-4", "pmid": 41174279, "year": 2026 } ], "date_precision": "day", "source_date": "2024-12-31T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:9MPP:deposition", "id": "9MPP", "kind": "deposition", "kind_label": "PDB deposition", "date": "2024-12-31", "sort_date": "2024-12-31", "year": 2024, "title": "The cryo-EM structure of nucleosome-bound DNA methyltransferases DNMT3A2 and DNMT3L", "url": "https://www.rcsb.org/structure/9MPP", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9MPP", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41594-025-01704-4", "title": "Mechanisms of DNMT3A-3L-mediated de novo DNA methylation on chromatin.", "url": "https://doi.org/10.1038/s41594-025-01704-4", "doi": "10.1038/s41594-025-01704-4", "pmid": 41174279, "year": 2026 } ], "date_precision": "day", "source_date": "2024-12-31T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "id": "DOI:10.1021/acs.jmedchem.5c01902", "reference_id": "REF:PDB:9KN9:primary", "reference_ids": [ "REF:PDB:9KN9:primary" ], "title": "Fragment-Based Screening of NSD2-PWWP1 Identifies Novel Covalent Allosteric Ligands That Diminish Methyllysine and DNA Binding Abilities of NSD2.", "authors": [ "Huang, Y.", "Li, Y.", "Chen, X.", "Wang, H.", "Wang, Q.", "Liu, S.", "Li, Y.", "Chen, Z.", "Ma, J.", "Huang, Z.", "Wan, J.", "Ren, Y.", "Min, J." ], "year": 2025, "year_values": [ 2025 ], "year_conflict": false, "journal": "J.Med.Chem.", "doi": "10.1021/acs.jmedchem.5c01902", "pmid": 41264880, "url": "https://doi.org/10.1021/acs.jmedchem.5c01902", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:9KN9:primary", "year": 2025, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1021/acs.jmedchem.5c01902" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9KN9", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9KNA", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9KNB", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1021/acs.jmedchem.5c01902", "kind": "publication", "kind_label": "Publication year", "date": "2025", "sort_date": "2025-00-00" }, { "id": "DOI:10.1021/acsmedchemlett.5c00396", "reference_id": "PMID:40959233", "reference_ids": [ "PMID:40959233" ], "title": "Structural and Molecular Insight into the PWWP1 Domain of NSD2 from the Discovery of Novel Binders Via DNA-Encoded Library Screening.", "authors": [ "Collie GW", "Ackroyd B", "Corbishley C", "O'Donovan DH", "Edwards A", "Gohlke A", "Guo X", "Howells B", "Li Y", "Madin A", "Milbradt AG", "Rivers EL", "Talapatra SK", "Underwood E", "Webb A" ], "year": 2025, "year_values": [ 2025 ], "year_conflict": false, "journal": "ACS medicinal chemistry letters", "doi": "10.1021/acsmedchemlett.5c00396", "pmid": 40959233, "url": "https://doi.org/10.1021/acsmedchemlett.5c00396", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "NSD2 PWWP1 DEL binders, extended construct, and engineered crystal systems", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:40959233", "year": 2025, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1021/acsmedchemlett.5c00396" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9FOC", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9FOE", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" }, { "domain_id": "UP:Q9BZ95:PWWP1", "gene": "NSD3", "domain_name": "PWWP1" } ], "ligands": [ { "name": "UNC6934", "preparation_id": "PREP:UNC6934", "chemical_identity_status": "exact_single_CCD_identity", "assay_ids": [ "PWWP11:ASSAY:0001", "PWWP:ASSAY:0014", "PWWP:ASSAY:0021" ], "evidence_classes": [ "censored_binding_limit", "direct_binding_affinity" ], "domain_ids": [ "UP:O96028:PWWP1", "UP:Q9BZ95:PWWP1" ] }, { "name": "compound 11 (Collie 2025)", "preparation_id": "PREP:COLLIE2025_11", "chemical_identity_status": "assayed_stereoisomeric_mixture_not_single_chemical_identity", "assay_ids": [ "PWWP11:ASSAY:0005", "PWWP:ASSAY:0018", "PWWP:ASSAY:0025" ], "evidence_classes": [ "direct_binding_affinity", "negative_binding_test" ], "domain_ids": [ "UP:O96028:PWWP1", "UP:Q9BZ95:PWWP1" ] }, { "name": "compound 12 (Collie 2025)", "preparation_id": "PREP:COLLIE2025_12", "chemical_identity_status": "paper_label_exact_identity_unresolved", "assay_ids": [ "PWWP11:ASSAY:0006", "PWWP:ASSAY:0019", "PWWP:ASSAY:0026", "PWWP:ASSAY:0030" ], "evidence_classes": [ "biochemical_interaction_inhibition", "direct_binding_affinity", "negative_binding_test" ], "domain_ids": [ "UP:O96028:PWWP1", "UP:Q9BZ95:PWWP1" ] }, { "name": "compound 13 (Collie 2025)", "preparation_id": "PREP:COLLIE2025_13", "chemical_identity_status": "paper_label_exact_identity_unresolved", "assay_ids": [ "PWWP11:ASSAY:0007", "PWWP:ASSAY:0020", "PWWP:ASSAY:0027", "PWWP:ASSAY:0031" ], "evidence_classes": [ "biochemical_interaction_inhibition", "direct_binding_affinity", "negative_binding_test" ], "domain_ids": [ "UP:O96028:PWWP1", "UP:Q9BZ95:PWWP1" ] }, { "name": "compound 5 (Collie 2025)", "preparation_id": "PREP:COLLIE2025_5", "chemical_identity_status": "assayed_stereoisomeric_mixture_not_single_chemical_identity", "assay_ids": [ "PWWP11:ASSAY:0002", "PWWP:ASSAY:0015", "PWWP:ASSAY:0022" ], "evidence_classes": [ "censored_binding_limit", "direct_binding_affinity" ], "domain_ids": [ "UP:O96028:PWWP1", "UP:Q9BZ95:PWWP1" ] }, { "name": "compound 6 (Collie 2025)", "preparation_id": "PREP:COLLIE2025_6", "chemical_identity_status": "paper_label_exact_identity_unresolved", "assay_ids": [ "PWWP11:ASSAY:0003", "PWWP:ASSAY:0016", "PWWP:ASSAY:0023", "PWWP:ASSAY:0028" ], "evidence_classes": [ "biochemical_interaction_inhibition", "censored_binding_limit", "direct_binding_affinity" ], "domain_ids": [ "UP:O96028:PWWP1", "UP:Q9BZ95:PWWP1" ] }, { "name": "compound 7 (Collie 2025)", "preparation_id": "PREP:COLLIE2025_7", "chemical_identity_status": "exact_single_CCD_identity", "assay_ids": [ "PWWP11:ASSAY:0004", "PWWP:ASSAY:0017", "PWWP:ASSAY:0024", "PWWP:ASSAY:0029" ], "evidence_classes": [ "biochemical_interaction_inhibition", "censored_binding_limit", "direct_binding_affinity" ], "domain_ids": [ "UP:O96028:PWWP1", "UP:Q9BZ95:PWWP1" ] } ], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1021/acsmedchemlett.5c00396", "kind": "publication", "kind_label": "Publication year", "date": "2025", "sort_date": "2025-00-00" }, { "id": "DOI:10.1038/s42003-025-07895-2", "reference_id": "PMID:40089621", "reference_ids": [ "PMID:40089621" ], "title": "Structural basis of thymidine-rich DNA recognition by Drosophila P75 PWWP domain.", "authors": [ "Jin Z", "Meng Z", "Liu Y", "Li C", "Zhang X", "Yin Y", "Gao G", "Dou K", "Huang Y" ], "year": 2025, "year_values": [ 2025 ], "year_conflict": false, "journal": "Communications biology", "doi": "10.1038/s42003-025-07895-2", "pmid": 40089621, "url": "https://doi.org/10.1038/s42003-025-07895-2", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Drosophila P75 PWWP thymidine-rich DNA recognition", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:40089621", "year": 2025, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1038/s42003-025-07895-2" } ], "proteins": [], "structures": [ { "pdb_id": "6KCO", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "6KD6", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/s42003-025-07895-2", "kind": "publication", "kind_label": "Publication year", "date": "2025", "sort_date": "2025-00-00" }, { "id": "DOI:10.1107/s2053230x25006302", "reference_id": "PMID:40709919", "reference_ids": [ "PMID:40709919" ], "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "authors": [ "Vantieghem T", "Osipov EM", "Beelen S", "Strelkov SV" ], "year": 2025, "year_values": [ 2025 ], "year_conflict": false, "journal": "Acta crystallographica. Section F, Structural biology communications", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "url": "https://doi.org/10.1107/s2053230x25006302", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "HRP2 PWWP C64S crystallization engineering and lattice comparison", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:40709919", "year": 2025, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1107/s2053230x25006302" } ], "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7A", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9I7B", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9I7C", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9I7D", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9I7E", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9I7F", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9I7G", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9I7H", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9I7I", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9I7J", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1107/s2053230x25006302", "kind": "publication", "kind_label": "Publication year", "date": "2025", "sort_date": "2025-00-00" }, { "id": "DOI:10.1126/sciadv.adu8116", "reference_id": "PMID:40138405", "reference_ids": [ "PMID:40138405" ], "title": "Histone modification-driven structural remodeling unleashes DNMT3B in DNA methylation.", "authors": [ "Cho CC", "Huang HH", "Jiang BC", "Yang WZ", "Chen YN", "Yuan HS" ], "year": 2025, "year_values": [ 2025 ], "year_conflict": false, "journal": "Science advances", "doi": "10.1126/sciadv.adu8116", "pmid": 40138405, "url": "https://doi.org/10.1126/sciadv.adu8116", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Histone-driven DNMT3B structural remodeling and DNA methylation", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:40138405", "year": 2025, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1126/sciadv.adu8116" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8ZLK", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1126/sciadv.adu8116", "kind": "publication", "kind_label": "Publication year", "date": "2025", "sort_date": "2025-00-00" }, { "event_id": "PDB:9LQ1:deposition", "id": "9LQ1", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-01-27", "sort_date": "2025-01-27", "year": 2025, "title": "Structure of human DNMT3A-TCL1A complex", "url": "https://www.rcsb.org/structure/9LQ1", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9LQ1", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-025-67710-8", "title": "Molecular basis for the inhibition of de novo DNA methylation by TCL1A.", "url": "https://doi.org/10.1038/s41467-025-67710-8", "doi": "10.1038/s41467-025-67710-8", "pmid": 41786706, "year": 2026 } ], "date_precision": "day", "source_date": "2025-01-27T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:9I7A:deposition", "id": "9I7A", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-01-31", "sort_date": "2025-01-31", "year": 2025, "title": "Crystal structure of HRP-2 PWWP domain with C64S mutation - Crystal form P1 type 1", "url": "https://www.rcsb.org/structure/9I7A", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7A", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-01-31T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9I7B:deposition", "id": "9I7B", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-01-31", "sort_date": "2025-01-31", "year": 2025, "title": "Crystal structure of HRP-2 PWWP domain with C64S mutation - Crystal form C2", "url": "https://www.rcsb.org/structure/9I7B", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7B", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-01-31T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9I7C:deposition", "id": "9I7C", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-01-31", "sort_date": "2025-01-31", "year": 2025, "title": "Crystal structure of wild-type HRP-2 PWWP domain - Crystal form P212121 type 1", "url": "https://www.rcsb.org/structure/9I7C", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7C", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-01-31T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9I7D:deposition", "id": "9I7D", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-01-31", "sort_date": "2025-01-31", "year": 2025, "title": "Crystal structure of wild-type HRP-2 PWWP domain - Crystal form P212121 type 2", "url": "https://www.rcsb.org/structure/9I7D", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7D", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-01-31T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9I7E:deposition", "id": "9I7E", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-01-31", "sort_date": "2025-01-31", "year": 2025, "title": "Crystal structure of HRP-2 PWWP domain with C64S mutation - Crystal form P1 type 2", "url": "https://www.rcsb.org/structure/9I7E", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7E", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-01-31T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9I7F:deposition", "id": "9I7F", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-01-31", "sort_date": "2025-01-31", "year": 2025, "title": "Crystal structure of HRP-2 PWWP domain with C64S mutation - Crystal form P21 type 1", "url": "https://www.rcsb.org/structure/9I7F", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7F", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-01-31T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9I7G:deposition", "id": "9I7G", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-01-31", "sort_date": "2025-01-31", "year": 2025, "title": "Crystal structure of HRP-2 PWWP domain with C64S mutation - Crystal form P21 type 3", "url": "https://www.rcsb.org/structure/9I7G", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7G", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-01-31T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9I7H:deposition", "id": "9I7H", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-01-31", "sort_date": "2025-01-31", "year": 2025, "title": "Crystal structure of HRP-2 PWWP domain with C64S mutation - Crystal form P21 type 2", "url": "https://www.rcsb.org/structure/9I7H", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7H", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-01-31T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9I7I:deposition", "id": "9I7I", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-01-31", "sort_date": "2025-01-31", "year": 2025, "title": "Crystal structure of HRP-2 PWWP domain with C64S mutation - Crystal form P212121", "url": "https://www.rcsb.org/structure/9I7I", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7I", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-01-31T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9I7J:deposition", "id": "9I7J", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-01-31", "sort_date": "2025-01-31", "year": 2025, "title": "Crystal structure of HRP-2 PWWP domain with C64S mutation - Crystal form P21212", "url": "https://www.rcsb.org/structure/9I7J", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7J", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-01-31T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8ZLK:release", "id": "8ZLK", "kind": "release", "kind_label": "PDB initial release", "date": "2025-04-02", "sort_date": "2025-04-02", "year": 2025, "title": "PWWP domain from human DNMT3B", "url": "https://www.rcsb.org/structure/8ZLK", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8ZLK", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9UBC3:PWWP1", "gene": "DNMT3B", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1126/sciadv.adu8116", "title": "Histone modification-driven structural remodeling unleashes DNMT3B in DNA methylation.", "url": "https://doi.org/10.1126/sciadv.adu8116", "doi": "10.1126/sciadv.adu8116", "pmid": 40138405, "year": 2025 } ], "date_precision": "day", "source_date": "2025-04-02T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8Z6C:release", "id": "8Z6C", "kind": "release", "kind_label": "PDB initial release", "date": "2025-04-23", "sort_date": "2025-04-23", "year": 2025, "title": "Crystal structure of HDGFRP2 PWWP domain in complex with 4-(4-bromo-1H-pyrazol-3-yl) pyridine", "url": "https://www.rcsb.org/structure/8Z6C", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8Z6C", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1002/1873-3468.14981", "title": "Fragment-based discovery of small molecule inhibitors of the HDGFRP2 PWWP domain.", "url": "https://doi.org/10.1002/1873-3468.14981", "doi": "10.1002/1873-3468.14981", "pmid": 39031937, "year": 2024 } ], "date_precision": "day", "source_date": "2025-04-23T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:8Z6O:release", "id": "8Z6O", "kind": "release", "kind_label": "PDB initial release", "date": "2025-04-23", "sort_date": "2025-04-23", "year": 2025, "title": "Crystal structure of HDGFRP2 PWWP domain in complex with Varenicline", "url": "https://www.rcsb.org/structure/8Z6O", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "8Z6O", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1002/1873-3468.14981", "title": "Fragment-based discovery of small molecule inhibitors of the HDGFRP2 PWWP domain.", "url": "https://doi.org/10.1002/1873-3468.14981", "doi": "10.1002/1873-3468.14981", "pmid": 39031937, "year": 2024 } ], "date_precision": "day", "source_date": "2025-04-23T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9S28:deposition", "id": "9S28", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-07-21", "sort_date": "2025-07-21", "year": 2025, "title": "MVV STC intasome in complex with LEDGF", "url": "https://www.rcsb.org/structure/9S28", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9S28", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-026-76698-8", "title": "Core nucleosomes are refractory to lentiviral DNA integration.", "url": "https://doi.org/10.1038/s41467-026-76698-8", "doi": "10.1038/s41467-026-76698-8", "pmid": 42749731, "year": 2026 } ], "date_precision": "day", "source_date": "2025-07-21T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:9S29:deposition", "id": "9S29", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-07-21", "sort_date": "2025-07-21", "year": 2025, "title": "MVV CSC intasome in complex with LEDGF", "url": "https://www.rcsb.org/structure/9S29", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9S29", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-026-76698-8", "title": "Core nucleosomes are refractory to lentiviral DNA integration.", "url": "https://doi.org/10.1038/s41467-026-76698-8", "doi": "10.1038/s41467-026-76698-8", "pmid": 42749731, "year": 2026 } ], "date_precision": "day", "source_date": "2025-07-21T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:9PRW:deposition", "id": "9PRW", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-07-24", "sort_date": "2025-07-24", "year": 2025, "title": "Cryo-EM structure of human DNMT3A/3L", "url": "https://www.rcsb.org/structure/9PRW", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9PRW", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-026-69563-1", "title": "Structural insight into hierarchical DNMT3A autoinhibition and its dysregulation in disease.", "url": "https://doi.org/10.1038/s41467-026-69563-1", "doi": "10.1038/s41467-026-69563-1", "pmid": 41708613, "year": 2026 } ], "date_precision": "day", "source_date": "2025-07-24T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9S81:deposition", "id": "9S81", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-08-05", "sort_date": "2025-08-05", "year": 2025, "title": "Crystal structure of the LEDGF PWWP domain", "url": "https://www.rcsb.org/structure/9S81", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9S81", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1002/pro.70726", "title": "De novo design of proteinaceous binders targeting the LEDGF PWWP domain.", "url": "https://doi.org/10.1002/pro.70726", "doi": "10.1002/pro.70726", "pmid": 42489162, "year": 2026 } ], "date_precision": "day", "source_date": "2025-08-05T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9S83:deposition", "id": "9S83", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-08-05", "sort_date": "2025-08-05", "year": 2025, "title": "Crystal structure of de novo designed binder JUBO4 and the LEDGF PWWP domain", "url": "https://www.rcsb.org/structure/9S83", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9S83", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1002/pro.70726", "title": "De novo design of proteinaceous binders targeting the LEDGF PWWP domain.", "url": "https://doi.org/10.1002/pro.70726", "doi": "10.1002/pro.70726", "pmid": 42489162, "year": 2026 } ], "date_precision": "day", "source_date": "2025-08-05T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9I7A:release", "id": "9I7A", "kind": "release", "kind_label": "PDB initial release", "date": "2025-08-13", "sort_date": "2025-08-13", "year": 2025, "title": "Crystal structure of HRP-2 PWWP domain with C64S mutation - Crystal form P1 type 1", "url": "https://www.rcsb.org/structure/9I7A", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7A", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-08-13T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9I7B:release", "id": "9I7B", "kind": "release", "kind_label": "PDB initial release", "date": "2025-08-13", "sort_date": "2025-08-13", "year": 2025, "title": "Crystal structure of HRP-2 PWWP domain with C64S mutation - Crystal form C2", "url": "https://www.rcsb.org/structure/9I7B", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7B", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-08-13T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9I7C:release", "id": "9I7C", "kind": "release", "kind_label": "PDB initial release", "date": "2025-08-13", "sort_date": "2025-08-13", "year": 2025, "title": "Crystal structure of wild-type HRP-2 PWWP domain - Crystal form P212121 type 1", "url": "https://www.rcsb.org/structure/9I7C", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7C", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-08-13T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9I7D:release", "id": "9I7D", "kind": "release", "kind_label": "PDB initial release", "date": "2025-08-13", "sort_date": "2025-08-13", "year": 2025, "title": "Crystal structure of wild-type HRP-2 PWWP domain - Crystal form P212121 type 2", "url": "https://www.rcsb.org/structure/9I7D", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7D", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-08-13T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9I7E:release", "id": "9I7E", "kind": "release", "kind_label": "PDB initial release", "date": "2025-08-13", "sort_date": "2025-08-13", "year": 2025, "title": "Crystal structure of HRP-2 PWWP domain with C64S mutation - Crystal form P1 type 2", "url": "https://www.rcsb.org/structure/9I7E", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7E", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-08-13T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9I7F:release", "id": "9I7F", "kind": "release", "kind_label": "PDB initial release", "date": "2025-08-13", "sort_date": "2025-08-13", "year": 2025, "title": "Crystal structure of HRP-2 PWWP domain with C64S mutation - Crystal form P21 type 1", "url": "https://www.rcsb.org/structure/9I7F", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7F", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-08-13T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9I7G:release", "id": "9I7G", "kind": "release", "kind_label": "PDB initial release", "date": "2025-08-13", "sort_date": "2025-08-13", "year": 2025, "title": "Crystal structure of HRP-2 PWWP domain with C64S mutation - Crystal form P21 type 3", "url": "https://www.rcsb.org/structure/9I7G", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7G", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-08-13T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9I7H:release", "id": "9I7H", "kind": "release", "kind_label": "PDB initial release", "date": "2025-08-13", "sort_date": "2025-08-13", "year": 2025, "title": "Crystal structure of HRP-2 PWWP domain with C64S mutation - Crystal form P21 type 2", "url": "https://www.rcsb.org/structure/9I7H", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7H", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-08-13T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9I7I:release", "id": "9I7I", "kind": "release", "kind_label": "PDB initial release", "date": "2025-08-13", "sort_date": "2025-08-13", "year": 2025, "title": "Crystal structure of HRP-2 PWWP domain with C64S mutation - Crystal form P212121", "url": "https://www.rcsb.org/structure/9I7I", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7I", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-08-13T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9I7J:release", "id": "9I7J", "kind": "release", "kind_label": "PDB initial release", "date": "2025-08-13", "sort_date": "2025-08-13", "year": 2025, "title": "Crystal structure of HRP-2 PWWP domain with C64S mutation - Crystal form P21212", "url": "https://www.rcsb.org/structure/9I7J", "proteins": [ { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9I7J", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1107/s2053230x25006302", "title": "Crystal engineering of the hepatoma-derived growth factor-related protein 2 PWWP domain towards crystallographic fragment screening.", "url": "https://doi.org/10.1107/s2053230x25006302", "doi": "10.1107/s2053230x25006302", "pmid": 40709919, "year": 2025 } ], "date_precision": "day", "source_date": "2025-08-13T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9Q7U:deposition", "id": "9Q7U", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-08-25", "sort_date": "2025-08-25", "year": 2025, "title": "Composite map for Cryo-EM structure of DNMT3A2-DNMT3B3 tetramer bound to 167H3K36me2-nucleosome", "url": "https://www.rcsb.org/structure/9Q7U", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9Q7U", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2025-08-25T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9XYC:deposition", "id": "9XYC", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-08-25", "sort_date": "2025-08-25", "year": 2025, "title": "Pol II-DSIF-SPT6-PAF1c-TFIIS-IWS1-ELOF1-LEDGF-nucleosome LEDGF+nucleosome map Q", "url": "https://www.rcsb.org/structure/9XYC", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9XYC", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkag357", "title": "Structure and function of IWS1 in transcription elongation.", "url": "https://doi.org/10.1093/nar/gkag357", "doi": "10.1093/nar/gkag357", "pmid": 42134803, "year": 2026 } ], "date_precision": "day", "source_date": "2025-08-25T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9Y4P:deposition", "id": "9Y4P", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-09-03", "sort_date": "2025-09-03", "year": 2025, "title": "Cryo-EM structure of DNMT3A2/3B3 in complex with H3K36me2 di-nucleosome with eight base pair linker", "url": "https://www.rcsb.org/structure/9Y4P", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9Y4P", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2025-09-03T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9FOC:release", "id": "9FOC", "kind": "release", "kind_label": "PDB initial release", "date": "2025-09-03", "sort_date": "2025-09-03", "year": 2025, "title": "Crystal structure of the PWWP1 domain of NSD2 bound by compound 11.", "url": "https://www.rcsb.org/structure/9FOC", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9FOC", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acsmedchemlett.5c00396", "title": "Structural and Molecular Insight into the PWWP1 Domain of NSD2 from the Discovery of Novel Binders Via DNA-Encoded Library Screening.", "url": "https://doi.org/10.1021/acsmedchemlett.5c00396", "doi": "10.1021/acsmedchemlett.5c00396", "pmid": 40959233, "year": 2025 } ], "date_precision": "day", "source_date": "2025-09-03T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9FOE:release", "id": "9FOE", "kind": "release", "kind_label": "PDB initial release", "date": "2025-09-03", "sort_date": "2025-09-03", "year": 2025, "title": "Crystal structure of the PWWP1 domain of NSD2 bound by compound 7.", "url": "https://www.rcsb.org/structure/9FOE", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9FOE", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acsmedchemlett.5c00396", "title": "Structural and Molecular Insight into the PWWP1 Domain of NSD2 from the Discovery of Novel Binders Via DNA-Encoded Library Screening.", "url": "https://doi.org/10.1021/acsmedchemlett.5c00396", "doi": "10.1021/acsmedchemlett.5c00396", "pmid": 40959233, "year": 2025 } ], "date_precision": "day", "source_date": "2025-09-03T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9Y60:deposition", "id": "9Y60", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-09-06", "sort_date": "2025-09-06", "year": 2025, "title": "Crystal structure of NSD2 PWWP1 domain in complex with (6R)-6-(3,5-dichlorophenyl)morpholin-3-one (ligand 2)", "url": "https://www.rcsb.org/structure/9Y60", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9Y60", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1182/blood.2025031998", "title": "NSD2 degradation remediates the oncogenic cistrome in t(4;14) multiple myeloma.", "url": "https://doi.org/10.1182/blood.2025031998", "doi": "10.1182/blood.2025031998", "pmid": 42371798, "year": 2026 } ], "date_precision": "day", "source_date": "2025-09-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9Y61:deposition", "id": "9Y61", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-09-06", "sort_date": "2025-09-06", "year": 2025, "title": "Cryo-EM structure of ternary complex NSD2-PWWP1:CRBN:DDB1 in complex with NSD2-LDD, an LDD degrader", "url": "https://www.rcsb.org/structure/9Y61", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9Y61", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1182/blood.2025031998", "title": "NSD2 degradation remediates the oncogenic cistrome in t(4;14) multiple myeloma.", "url": "https://doi.org/10.1182/blood.2025031998", "doi": "10.1182/blood.2025031998", "pmid": 42371798, "year": 2026 } ], "date_precision": "day", "source_date": "2025-09-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9MP0:release", "id": "9MP0", "kind": "release", "kind_label": "PDB initial release", "date": "2025-10-08", "sort_date": "2025-10-08", "year": 2025, "title": "The cryo-EM structure of the human DNA methyltransferases DNMT3A2 and DNMT3L dodecamer", "url": "https://www.rcsb.org/structure/9MP0", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9MP0", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41594-025-01704-4", "title": "Mechanisms of DNMT3A-3L-mediated de novo DNA methylation on chromatin.", "url": "https://doi.org/10.1038/s41594-025-01704-4", "doi": "10.1038/s41594-025-01704-4", "pmid": 41174279, "year": 2026 } ], "date_precision": "day", "source_date": "2025-10-08T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:9MPO:release", "id": "9MPO", "kind": "release", "kind_label": "PDB initial release", "date": "2025-10-08", "sort_date": "2025-10-08", "year": 2025, "title": "The cryo-EM structure of the human DNA methyltransferase DNMT3A2 and DNMT3L octamer", "url": "https://www.rcsb.org/structure/9MPO", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9MPO", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41594-025-01704-4", "title": "Mechanisms of DNMT3A-3L-mediated de novo DNA methylation on chromatin.", "url": "https://doi.org/10.1038/s41594-025-01704-4", "doi": "10.1038/s41594-025-01704-4", "pmid": 41174279, "year": 2026 } ], "date_precision": "day", "source_date": "2025-10-08T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:9MPP:release", "id": "9MPP", "kind": "release", "kind_label": "PDB initial release", "date": "2025-10-08", "sort_date": "2025-10-08", "year": 2025, "title": "The cryo-EM structure of nucleosome-bound DNA methyltransferases DNMT3A2 and DNMT3L", "url": "https://www.rcsb.org/structure/9MPP", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9MPP", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41594-025-01704-4", "title": "Mechanisms of DNMT3A-3L-mediated de novo DNA methylation on chromatin.", "url": "https://doi.org/10.1038/s41594-025-01704-4", "doi": "10.1038/s41594-025-01704-4", "pmid": 41174279, "year": 2026 } ], "date_precision": "day", "source_date": "2025-10-08T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:9T2F:deposition", "id": "9T2F", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-10-22", "sort_date": "2025-10-22", "year": 2025, "title": "Crystal structure of human PRKCBP1 Zinc finger MYND-type containing 8 with pentaglutamate tag", "url": "https://www.rcsb.org/structure/9T2F", "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9T2F", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9ULU4:PWWP1", "gene": "ZMYND8", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:9T2F:primary", "title": "A fast, parallel method for efficiently exploring crystallization behaviour of large numbers of protein variants", "url": "https://www.rcsb.org/structure/9T2F", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2025-10-22T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9T2G:deposition", "id": "9T2G", "kind": "deposition", "kind_label": "PDB deposition", "date": "2025-10-22", "sort_date": "2025-10-22", "year": 2025, "title": "Human PRKCBP1 zinc finger MYND-type containing 8 with crystallization epitope mutations N221R:M226H", "url": "https://www.rcsb.org/structure/9T2G", "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9T2G", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9ULU4:PWWP1", "gene": "ZMYND8", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:9T2G:primary", "title": "A fast, parallel method for efficiently exploring crystallization behaviour of large numbers of protein variants", "url": "https://www.rcsb.org/structure/9T2G", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2025-10-22T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9LQ1:release", "id": "9LQ1", "kind": "release", "kind_label": "PDB initial release", "date": "2025-11-05", "sort_date": "2025-11-05", "year": 2025, "title": "Structure of human DNMT3A-TCL1A complex", "url": "https://www.rcsb.org/structure/9LQ1", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9LQ1", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-025-67710-8", "title": "Molecular basis for the inhibition of de novo DNA methylation by TCL1A.", "url": "https://doi.org/10.1038/s41467-025-67710-8", "doi": "10.1038/s41467-025-67710-8", "pmid": 41786706, "year": 2026 } ], "date_precision": "day", "source_date": "2025-11-05T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:9KN9:release", "id": "9KN9", "kind": "release", "kind_label": "PDB initial release", "date": "2025-11-26", "sort_date": "2025-11-26", "year": 2025, "title": "NSD2-PWWP1 domain bound with compound 1.", "url": "https://www.rcsb.org/structure/9KN9", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9KN9", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acs.jmedchem.5c01902", "title": "Fragment-Based Screening of NSD2-PWWP1 Identifies Novel Covalent Allosteric Ligands That Diminish Methyllysine and DNA Binding Abilities of NSD2.", "url": "https://doi.org/10.1021/acs.jmedchem.5c01902", "doi": "10.1021/acs.jmedchem.5c01902", "pmid": 41264880, "year": 2025 } ], "date_precision": "day", "source_date": "2025-11-26T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9KNA:release", "id": "9KNA", "kind": "release", "kind_label": "PDB initial release", "date": "2025-11-26", "sort_date": "2025-11-26", "year": 2025, "title": "NSD2-PWWP1 domain bound with compound 6", "url": "https://www.rcsb.org/structure/9KNA", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9KNA", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acs.jmedchem.5c01902", "title": "Fragment-Based Screening of NSD2-PWWP1 Identifies Novel Covalent Allosteric Ligands That Diminish Methyllysine and DNA Binding Abilities of NSD2.", "url": "https://doi.org/10.1021/acs.jmedchem.5c01902", "doi": "10.1021/acs.jmedchem.5c01902", "pmid": 41264880, "year": 2025 } ], "date_precision": "day", "source_date": "2025-11-26T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9KNB:release", "id": "9KNB", "kind": "release", "kind_label": "PDB initial release", "date": "2025-11-26", "sort_date": "2025-11-26", "year": 2025, "title": "NSD2-PWWP1 domain bound with compound 9", "url": "https://www.rcsb.org/structure/9KNB", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9KNB", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1021/acs.jmedchem.5c01902", "title": "Fragment-Based Screening of NSD2-PWWP1 Identifies Novel Covalent Allosteric Ligands That Diminish Methyllysine and DNA Binding Abilities of NSD2.", "url": "https://doi.org/10.1021/acs.jmedchem.5c01902", "doi": "10.1021/acs.jmedchem.5c01902", "pmid": 41264880, "year": 2025 } ], "date_precision": "day", "source_date": "2025-11-26T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9T2G:release", "id": "9T2G", "kind": "release", "kind_label": "PDB initial release", "date": "2025-11-26", "sort_date": "2025-11-26", "year": 2025, "title": "Human PRKCBP1 zinc finger MYND-type containing 8 with crystallization epitope mutations N221R:M226H", "url": "https://www.rcsb.org/structure/9T2G", "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9T2G", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9ULU4:PWWP1", "gene": "ZMYND8", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:9T2G:primary", "title": "A fast, parallel method for efficiently exploring crystallization behaviour of large numbers of protein variants", "url": "https://www.rcsb.org/structure/9T2G", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2025-11-26T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9T2F:release", "id": "9T2F", "kind": "release", "kind_label": "PDB initial release", "date": "2025-12-17", "sort_date": "2025-12-17", "year": 2025, "title": "Crystal structure of human PRKCBP1 Zinc finger MYND-type containing 8 with pentaglutamate tag", "url": "https://www.rcsb.org/structure/9T2F", "proteins": [ { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9T2F", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9ULU4:PWWP1", "gene": "ZMYND8", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "REF:PDB:9T2F:primary", "title": "A fast, parallel method for efficiently exploring crystallization behaviour of large numbers of protein variants", "url": "https://www.rcsb.org/structure/9T2F", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2025-12-17T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9PRW:release", "id": "9PRW", "kind": "release", "kind_label": "PDB initial release", "date": "2025-12-31", "sort_date": "2025-12-31", "year": 2025, "title": "Cryo-EM structure of human DNMT3A/3L", "url": "https://www.rcsb.org/structure/9PRW", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9PRW", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-026-69563-1", "title": "Structural insight into hierarchical DNMT3A autoinhibition and its dysregulation in disease.", "url": "https://doi.org/10.1038/s41467-026-69563-1", "doi": "10.1038/s41467-026-69563-1", "pmid": 41708613, "year": 2026 } ], "date_precision": "day", "source_date": "2025-12-31T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "id": "DOI:10.1002/pro.70726", "reference_id": "PMID:42489162", "reference_ids": [ "PMID:42489162" ], "title": "De novo design of proteinaceous binders targeting the LEDGF PWWP domain.", "authors": [ "Vantieghem T", "Delepine J", "Noppen S", "Beelen S", "Drexler M", "Holková J", "Houser J", "Veverka V", "Schols D", "Strelkov SV" ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Protein science : a publication of the Protein Society", "doi": "10.1002/pro.70726", "pmid": 42489162, "url": "https://doi.org/10.1002/pro.70726", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Designed JUBO protein binders and LEDGF PWWP complex", "verification_level": "primary_abstract_and_data_availability_verified", "source_records": [ { "reference_id": "PMID:42489162", "year": 2026, "source_type": "primary_experimental_research", "verification_level": "primary_abstract_and_data_availability_verified", "url": "https://doi.org/10.1002/pro.70726" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9S81", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9S83", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1002/pro.70726", "kind": "publication", "kind_label": "Publication year", "date": "2026", "sort_date": "2026-00-00" }, { "id": "DOI:10.1016/j.bmc.2026.118751", "reference_id": "PMID:42442058", "reference_ids": [ "PMID:42442058" ], "title": "Discovery and biological evaluation of HS13 as a novel covalent ligand targeting the NSD2-PWWP1 domain.", "authors": [ "Liu C", "Wang Q", "Xie X", "Wang H", "Liu S", "Li B", "Min J", "Chen X", "Huang Y" ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Bioorganic & medicinal chemistry", "doi": "10.1016/j.bmc.2026.118751", "pmid": 42442058, "url": "https://doi.org/10.1016/j.bmc.2026.118751", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "HS13 covalent NSD2 PWWP1 ligand", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:42442058", "year": 2026, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.bmc.2026.118751" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [ { "name": "HS13", "preparation_id": "PREP:HS13", "chemical_identity_status": "paper_label_exact_identity_unresolved", "assay_ids": [ "PWWP:ASSAY:0035" ], "evidence_classes": [ "abstract_reported_covalent_association" ], "domain_ids": [ "UP:O96028:PWWP1" ] } ], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.bmc.2026.118751", "kind": "publication", "kind_label": "Publication year", "date": "2026", "sort_date": "2026-00-00" }, { "id": "DOI:10.1016/j.molcel.2026.01.030", "reference_id": "PMID:41742418", "reference_ids": [ "PMID:41742418" ], "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "authors": [ "Xie X", "Liu M", "Chua GNL", "Zhou XE", "Dykstra ML", "Liu S", "Jones PA", "Worden EJ" ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Molecular cell", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Nucleosome spacing and linker methylation structural context", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:41742418", "year": 2026, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1016/j.molcel.2026.01.030" } ], "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E00", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "9E05", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9E0F", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9E0G", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9E2D", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9E2Q", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "9E2R", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9E3D", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9E3R", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "9Q7U", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9Y4P", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1016/j.molcel.2026.01.030", "kind": "publication", "kind_label": "Publication year", "date": "2026", "sort_date": "2026-00-00" }, { "id": "DOI:10.1021/acs.analchem.5c07785", "reference_id": "PMID:41820229", "reference_ids": [ "PMID:41820229" ], "title": "Fluorogenic Ligand Enables Identification of NSD3-Overexpressed Tumors by Targeting the PWWP1 Domain of NSD3.", "authors": [ "Li Y", "Shao S", "Lei Q", "Song C", "Wang S", "Deng H" ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Analytical chemistry", "doi": "10.1021/acs.analchem.5c07785", "pmid": 41820229, "url": "https://doi.org/10.1021/acs.analchem.5c07785", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "NSD3 PWWP1-targeting fluorogenic ligand", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:41820229", "year": 2026, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1021/acs.analchem.5c07785" } ], "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1021/acs.analchem.5c07785", "kind": "publication", "kind_label": "Publication year", "date": "2026", "sort_date": "2026-00-00" }, { "id": "DOI:10.1021/acs.jmedchem.6c00983", "reference_id": "PMID:42503659", "reference_ids": [ "PMID:42503659" ], "title": "AI-Driven Discovery of a Hydrophobic-Tag Degrader Targeting NSD3 for Lung Squamous Carcinoma Therapy.", "authors": [ "Xiu SY", "Jia ZY", "Li Q", "Zhu WY", "Wang H", "Shi C", "Zhou JX", "Sun XJ", "Zhang XY", "Wang YY", "Chi XW", "Zhang LR", "Liu ZM" ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Journal of medicinal chemistry", "doi": "10.1021/acs.jmedchem.6c00983", "pmid": 42503659, "url": "https://doi.org/10.1021/acs.jmedchem.6c00983", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Published AI-driven NSD3 degrader discovery", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:42503659", "year": 2026, "source_type": "primary_experimental_research", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1021/acs.jmedchem.6c00983" } ], "proteins": [ { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1021/acs.jmedchem.6c00983", "kind": "publication", "kind_label": "Publication year", "date": "2026", "sort_date": "2026-00-00" }, { "id": "DOI:10.1038/s41467-025-67710-8", "reference_id": "REF:PDB:9LQ1:primary", "reference_ids": [ "REF:PDB:9LQ1:primary" ], "title": "Molecular basis for the inhibition of de novo DNA methylation by TCL1A.", "authors": [ "Liu, Q.", "Li, J.", "Wang, X.", "Li, Y.", "Wu, Y.", "Han, Z.", "Guo, Z.", "Guo, L.", "Wang, X.", "Yuan, G.", "Gao, Z.", "Li, L.", "Deng, D." ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Nat Commun", "doi": "10.1038/s41467-025-67710-8", "pmid": 41786706, "url": "https://doi.org/10.1038/s41467-025-67710-8", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:9LQ1:primary", "year": 2026, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1038/s41467-025-67710-8" } ], "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9LQ1", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/s41467-025-67710-8", "kind": "publication", "kind_label": "Publication year", "date": "2026", "sort_date": "2026-00-00" }, { "id": "DOI:10.1038/s41467-026-69563-1", "reference_id": "PMID:41708613", "reference_ids": [ "PMID:41708613" ], "title": "Structural insight into hierarchical DNMT3A autoinhibition and its dysregulation in disease.", "authors": [ "Lu J", "Vig E", "Chen J", "Gretarsson KH", "Khudaverdyan N", "Shao Z", "Lu C", "Chang CA", "Song J" ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Nature communications", "doi": "10.1038/s41467-026-69563-1", "pmid": 41708613, "url": "https://doi.org/10.1038/s41467-026-69563-1", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Hierarchical DNMT3A autoinhibition; review coordinate-level PWWP coverage", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:41708613", "year": 2026, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.1038/s41467-026-69563-1" } ], "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9PRW", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/s41467-026-69563-1", "kind": "publication", "kind_label": "Publication year", "date": "2026", "sort_date": "2026-00-00" }, { "id": "DOI:10.1038/s41467-026-72235-9", "reference_id": "REF:PDB:29HG:primary", "reference_ids": [ "REF:PDB:29HG:primary" ], "title": "Structural basis of NSD2 degradation via targeted recruitment of SCF-FBXO22.", "authors": [ "Robertson, K.C.", "Amann, S.J.", "Liu, T.", "Funk, A.V.", "Wang, X.", "Grishkovskaya, I.", "Mehmood, A.", "Tabor, J.R.", "Norris-Drouin, J.L.", "Arrowsmith, C.H.", "Collins, J.L.", "Miao, Y.", "Emanuele, M.J.", "Haselbach, D.", "James, L.I.", "Brown, N.G." ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Nat Commun", "doi": "10.1038/s41467-026-72235-9", "pmid": 42026065, "url": "https://doi.org/10.1038/s41467-026-72235-9", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:29HG:primary", "year": 2026, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1038/s41467-026-72235-9" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "29HG", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "29HH", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "29HI", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/s41467-026-72235-9", "kind": "publication", "kind_label": "Publication year", "date": "2026", "sort_date": "2026-00-00" }, { "id": "DOI:10.1038/s41467-026-76698-8", "reference_id": "REF:PDB:9S28:primary", "reference_ids": [ "REF:PDB:9S28:primary" ], "title": "Core nucleosomes are refractory to lentiviral DNA integration.", "authors": [ "Hope, J.", "Punch, E.", "Cook, N.J.", "Singer, M.R.", "Joshi, D.", "Singh, P.K.", "Nans, A.", "Sweeney, N.P.", "Vanderlinden, W.", "Engelman, A.N.", "Cherepanov, P." ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Nat Commun", "doi": "10.1038/s41467-026-76698-8", "pmid": 42749731, "url": "https://doi.org/10.1038/s41467-026-76698-8", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:9S28:primary", "year": 2026, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1038/s41467-026-76698-8" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9S28", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "9S29", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/s41467-026-76698-8", "kind": "publication", "kind_label": "Publication year", "date": "2026", "sort_date": "2026-00-00" }, { "id": "DOI:10.1038/s41594-025-01704-4", "reference_id": "REF:PDB:9MP0:primary", "reference_ids": [ "REF:PDB:9MP0:primary" ], "title": "Mechanisms of DNMT3A-3L-mediated de novo DNA methylation on chromatin.", "authors": [ "Yan, Y.", "Zhou, X.E.", "Thomas, S.L.", "Liu, M.", "Lai, G.Q.", "Worden, E.J.", "Jones, P.A.", "Xu, T.H." ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Nat.Struct.Mol.Biol.", "doi": "10.1038/s41594-025-01704-4", "pmid": 41174279, "url": "https://doi.org/10.1038/s41594-025-01704-4", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:9MP0:primary", "year": 2026, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1038/s41594-025-01704-4" } ], "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9MP0", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "9MPO", "in_atlas": true, "observed_pwwp": false }, { "pdb_id": "9MPP", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1038/s41594-025-01704-4", "kind": "publication", "kind_label": "Publication year", "date": "2026", "sort_date": "2026-00-00" }, { "id": "DOI:10.1073/pnas.2609226123", "reference_id": "REF:PDB:11NZ:primary", "reference_ids": [ "REF:PDB:11NZ:primary" ], "title": "Multidomain interaction governs the filamentous assembly of the dominant-negative DNMT3A R882H mutant.", "authors": [ "Chen, J.", "Lu, J.", "Long, Z.", "Yoon, S.", "Fukunaga, M.", "Song, J." ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Proc.Natl.Acad.Sci.USA", "doi": "10.1073/pnas.2609226123", "pmid": 42640801, "url": "https://doi.org/10.1073/pnas.2609226123", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:11NZ:primary", "year": 2026, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1073/pnas.2609226123" } ], "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "11NZ", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "11OA", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "11OH", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "11OI", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1073/pnas.2609226123", "kind": "publication", "kind_label": "Publication year", "date": "2026", "sort_date": "2026-00-00" }, { "id": "DOI:10.1080/07391102.2026.2698738", "reference_id": "PMID:42444282", "reference_ids": [ "PMID:42444282" ], "title": "Computational analysis of non-synonymous SNPs-induced structural perturbations and histone binding alterations in the PWWP domain of PWWP2A and PWWP2B proteins.", "authors": [ "M S", "N S", "Oviya IR", "R J", "Ganesh I", "Chinnadurai RK", "Ponne S" ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Journal of biomolecular structure & dynamics", "doi": "10.1080/07391102.2026.2698738", "pmid": 42444282, "url": "https://doi.org/10.1080/07391102.2026.2698738", "source_type": "primary_computational_study", "citation_role": "pwwp_research_context", "citation_role_label": "Computational study", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Published computational variant study; computational rather than experimental evidence", "verification_level": "bibliographic_metadata_and_abstract_verified", "source_records": [ { "reference_id": "PMID:42444282", "year": 2026, "source_type": "primary_computational_study", "verification_level": "bibliographic_metadata_and_abstract_verified", "url": "https://doi.org/10.1080/07391102.2026.2698738" } ], "proteins": [ { "protein_id": "UP:Q6NUJ5", "uniprot": "Q6NUJ5", "gene": "PWWP2B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q96N64", "uniprot": "Q96N64", "gene": "PWWP2A", "organism": "Homo sapiens" } ], "structures": [], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1080/07391102.2026.2698738", "kind": "publication", "kind_label": "Publication year", "date": "2026", "sort_date": "2026-00-00" }, { "id": "DOI:10.1093/nar/gkag357", "reference_id": "REF:PDB:9XYC:primary", "reference_ids": [ "REF:PDB:9XYC:primary" ], "title": "Structure and function of IWS1 in transcription elongation.", "authors": [ "Syau, D.", "Steinruecke, F.", "Roth, S.", "Schmid, E.", "Adelman, K.", "Walter, J.C.", "Farnung, L." ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Nucleic Acids Res.", "doi": "10.1093/nar/gkag357", "pmid": 42134803, "url": "https://doi.org/10.1093/nar/gkag357", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:9XYC:primary", "year": 2026, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1093/nar/gkag357" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9XYC", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1093/nar/gkag357", "kind": "publication", "kind_label": "Publication year", "date": "2026", "sort_date": "2026-00-00" }, { "id": "DOI:10.1182/blood.2025031998", "reference_id": "REF:PDB:9Y60:primary", "reference_ids": [ "REF:PDB:9Y60:primary" ], "title": "NSD2 degradation remediates the oncogenic cistrome in t(4;14) multiple myeloma.", "authors": [ "Hu, B.", "Edwards, J.T.", "Modi, H.", "Gamez, J.", "Echeagaray, O.", "Hess, K.", "Ren, Y.", "Anderson, D.", "Larrayoz, M.", "Zhu, J.", "Johnson, S.", "Deb, G.", "Jankeel, D.", "Janardhanan, P.", "Leisten, J.", "Peng, S.", "Christoforou, A.", "Stong, N.", "Fontanillo, C.", "Bjorklund, C.C.", "Hagner, P.R.", "Gandhi, A.K.", "Martinez-Climent, J.A.", "Narla, R.K.", "Lopez-Girona, A.", "Rolfe, M.", "Bence, N.", "Mortensen, D.S.", "Groocock, L." ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Blood", "doi": "10.1182/blood.2025031998", "pmid": 42371798, "url": "https://doi.org/10.1182/blood.2025031998", "source_type": "experimental_deposition_bibliography", "citation_role": "pwwp_research_context", "citation_role_label": "Deposition-linked bibliography", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "Citation accompanying an included PWWP-domain deposition", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "source_records": [ { "reference_id": "REF:PDB:9Y60:primary", "year": 2026, "source_type": "experimental_deposition_bibliography", "verification_level": "PDB citation metadata; original paper not independently reviewed unless curated record is linked", "url": "https://doi.org/10.1182/blood.2025031998" } ], "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9Y60", "in_atlas": true, "observed_pwwp": true }, { "pdb_id": "9Y61", "in_atlas": true, "observed_pwwp": true } ], "domains": [], "ligands": [], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.1182/blood.2025031998", "kind": "publication", "kind_label": "Publication year", "date": "2026", "sort_date": "2026-00-00" }, { "id": "DOI:10.3390/biom16050716", "reference_id": "PMID:42194065", "reference_ids": [ "PMID:42194065" ], "title": "High-Affinity Nanobody Against the LEDGF PWWP Domain Inhibits Chromatin Binding In Vitro.", "authors": [ "Vantieghem T", "Jansen S", "Akele TZ", "Van Maele P", "Noppen S", "Schols D", "Dewilde M", "Debyser Z", "Strelkov SV" ], "year": 2026, "year_values": [ 2026 ], "year_conflict": false, "journal": "Biomolecules", "doi": "10.3390/biom16050716", "pmid": 42194065, "url": "https://doi.org/10.3390/biom16050716", "source_type": "primary_experimental_research", "citation_role": "pwwp_research_context", "citation_role_label": "Experimental research", "citation_role_basis": "Display scope follows the frozen bibliography record; no new functional milestone is inferred.", "relevance": "PWWP nanobody binding; binder-alone crystal structures are not PWWP structures", "verification_level": "primary_full_text_sections_verified", "source_records": [ { "reference_id": "PMID:42194065", "year": 2026, "source_type": "primary_experimental_research", "verification_level": "primary_full_text_sections_verified", "url": "https://doi.org/10.3390/biom16050716" } ], "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" }, { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" } ], "structures": [], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" }, { "domain_id": "UP:Q7Z4V5:PWWP1", "gene": "HDGFL2", "domain_name": "PWWP1" } ], "ligands": [ { "name": "NbH10", "preparation_id": "PREP:NbH10", "chemical_identity_status": "named_macromolecule_no_full_sequence_identity", "assay_ids": [ "PWWP11:ASSAY:0008", "PWWP11:ASSAY:0009", "PWWP:ASSAY:0032" ], "evidence_classes": [ "biochemical_interaction_inhibition", "direct_binding_affinity" ], "domain_ids": [ "UP:O75475:PWWP1", "UP:Q7Z4V5:PWWP1" ] } ], "date_precision": "year", "date_note": "Publication year recorded in the frozen bibliography; no month or day inferred.", "is_publication": true, "event_id": "PUB:DOI:10.3390/biom16050716", "kind": "publication", "kind_label": "Publication year", "date": "2026", "sort_date": "2026-00-00" }, { "event_id": "PDB:9E3U:release", "id": "9E3U", "kind": "release", "kind_label": "PDB initial release", "date": "2026-01-21", "sort_date": "2026-01-21", "year": 2026, "title": "Cryo-EM structure of DNMT 3A2/3B3 tetramer bound to a di-nucleosome with a 25 base-pair linker", "url": "https://www.rcsb.org/structure/9E3U", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E3U", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "REF:PDB:9E3U:primary", "title": "The structural basis for de novo DNA methylation in chromatin", "url": "https://www.rcsb.org/structure/9E3U", "doi": null, "pmid": null, "year": null } ], "date_precision": "day", "source_date": "2026-01-21T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:9E05:release", "id": "9E05", "kind": "release", "kind_label": "PDB initial release", "date": "2026-02-18", "sort_date": "2026-02-18", "year": 2026, "title": "The consensus model of the cryo-EM structure of human DNMT3A2-DNMT3B3 complex bound to di-nucleosome", "url": "https://www.rcsb.org/structure/9E05", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E05", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2026-02-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9E0F:release", "id": "9E0F", "kind": "release", "kind_label": "PDB initial release", "date": "2026-02-18", "sort_date": "2026-02-18", "year": 2026, "title": "A focus of DNMT tetramer (1) of the cryo-EM structure of human DNMT3A2-DNMT3B3 complex bound to di-nucleosome", "url": "https://www.rcsb.org/structure/9E0F", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E0F", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2026-02-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9E0G:release", "id": "9E0G", "kind": "release", "kind_label": "PDB initial release", "date": "2026-02-18", "sort_date": "2026-02-18", "year": 2026, "title": "A focus of tetramer (2) of the cryo-EM structure of human DNMT3A2-DNMT3B3 complex bound to di-nucleosome", "url": "https://www.rcsb.org/structure/9E0G", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E0G", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2026-02-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9E2D:release", "id": "9E2D", "kind": "release", "kind_label": "PDB initial release", "date": "2026-02-18", "sort_date": "2026-02-18", "year": 2026, "title": "Cryo-EM structure of human DNMT3A2-DNMT3B3 complex bound to a di-nucleosome with a five base pair linker", "url": "https://www.rcsb.org/structure/9E2D", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E2D", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2026-02-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9E2Q:release", "id": "9E2Q", "kind": "release", "kind_label": "PDB initial release", "date": "2026-02-18", "sort_date": "2026-02-18", "year": 2026, "title": "Cryo-EM structure of DNMT 3A2/3B3 tetramer in complex with a di-nucleosome with a six base pair linker", "url": "https://www.rcsb.org/structure/9E2Q", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E2Q", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2026-02-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:9E2R:release", "id": "9E2R", "kind": "release", "kind_label": "PDB initial release", "date": "2026-02-18", "sort_date": "2026-02-18", "year": 2026, "title": "Cryo-EM structure of human DNMT3A2-DNMT3B3 complex bound to a di-nucleosome and an histone-3 peptide", "url": "https://www.rcsb.org/structure/9E2R", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E2R", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2026-02-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9E3D:release", "id": "9E3D", "kind": "release", "kind_label": "PDB initial release", "date": "2026-02-18", "sort_date": "2026-02-18", "year": 2026, "title": "Cryo-EM structure of DNMT 3A2/3B3 tetramer in complex with a di-nucleosome with K120R mutant H2B", "url": "https://www.rcsb.org/structure/9E3D", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E3D", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2026-02-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9E3R:release", "id": "9E3R", "kind": "release", "kind_label": "PDB initial release", "date": "2026-02-18", "sort_date": "2026-02-18", "year": 2026, "title": "Cryo-EM structure of PWWP domain deleted DNMT 3A2/3B3 in complex with a di-nucleosome", "url": "https://www.rcsb.org/structure/9E3R", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E3R", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2026-02-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:9Q7U:release", "id": "9Q7U", "kind": "release", "kind_label": "PDB initial release", "date": "2026-02-18", "sort_date": "2026-02-18", "year": 2026, "title": "Composite map for Cryo-EM structure of DNMT3A2-DNMT3B3 tetramer bound to 167H3K36me2-nucleosome", "url": "https://www.rcsb.org/structure/9Q7U", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9Q7U", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2026-02-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9Y4P:release", "id": "9Y4P", "kind": "release", "kind_label": "PDB initial release", "date": "2026-02-18", "sort_date": "2026-02-18", "year": 2026, "title": "Cryo-EM structure of DNMT3A2/3B3 in complex with H3K36me2 di-nucleosome with eight base pair linker", "url": "https://www.rcsb.org/structure/9Y4P", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9Y4P", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2026-02-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9E00:release", "id": "9E00", "kind": "release", "kind_label": "PDB initial release", "date": "2026-02-25", "sort_date": "2026-02-25", "year": 2026, "title": "Cryo-EM structure of human DNMT3A2-DNMT3B3 complex bound to di-nucleosome", "url": "https://www.rcsb.org/structure/9E00", "proteins": [ { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9E00", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1016/j.molcel.2026.01.030", "title": "Nucleosome spacing regulates linker methylation by DNMT3A2/3B3.", "url": "https://doi.org/10.1016/j.molcel.2026.01.030", "doi": "10.1016/j.molcel.2026.01.030", "pmid": 41742418, "year": 2026 } ], "date_precision": "day", "source_date": "2026-02-25T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:11NZ:deposition", "id": "11NZ", "kind": "deposition", "kind_label": "PDB deposition", "date": "2026-03-05", "sort_date": "2026-03-05", "year": 2026, "title": "Cryo-EM structure of human DNMT3A R882H decamer", "url": "https://www.rcsb.org/structure/11NZ", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "11NZ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1073/pnas.2609226123", "title": "Multidomain interaction governs the filamentous assembly of the dominant-negative DNMT3A R882H mutant.", "url": "https://doi.org/10.1073/pnas.2609226123", "doi": "10.1073/pnas.2609226123", "pmid": 42640801, "year": 2026 } ], "date_precision": "day", "source_date": "2026-03-05T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:11OA:deposition", "id": "11OA", "kind": "deposition", "kind_label": "PDB deposition", "date": "2026-03-05", "sort_date": "2026-03-05", "year": 2026, "title": "Cryo-EM structure of human DNMT3A R882H octadecamer", "url": "https://www.rcsb.org/structure/11OA", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "11OA", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1073/pnas.2609226123", "title": "Multidomain interaction governs the filamentous assembly of the dominant-negative DNMT3A R882H mutant.", "url": "https://doi.org/10.1073/pnas.2609226123", "doi": "10.1073/pnas.2609226123", "pmid": 42640801, "year": 2026 } ], "date_precision": "day", "source_date": "2026-03-05T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:11OH:deposition", "id": "11OH", "kind": "deposition", "kind_label": "PDB deposition", "date": "2026-03-06", "sort_date": "2026-03-06", "year": 2026, "title": "Cryo-EM structure of human DNMT3A homo-tetramer", "url": "https://www.rcsb.org/structure/11OH", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "11OH", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1073/pnas.2609226123", "title": "Multidomain interaction governs the filamentous assembly of the dominant-negative DNMT3A R882H mutant.", "url": "https://doi.org/10.1073/pnas.2609226123", "doi": "10.1073/pnas.2609226123", "pmid": 42640801, "year": 2026 } ], "date_precision": "day", "source_date": "2026-03-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:11OI:deposition", "id": "11OI", "kind": "deposition", "kind_label": "PDB deposition", "date": "2026-03-06", "sort_date": "2026-03-06", "year": 2026, "title": "Cryo-EM structure of human DNMT3A homo-hexamer", "url": "https://www.rcsb.org/structure/11OI", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "11OI", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1073/pnas.2609226123", "title": "Multidomain interaction governs the filamentous assembly of the dominant-negative DNMT3A R882H mutant.", "url": "https://doi.org/10.1073/pnas.2609226123", "doi": "10.1073/pnas.2609226123", "pmid": 42640801, "year": 2026 } ], "date_precision": "day", "source_date": "2026-03-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:29HG:deposition", "id": "29HG", "kind": "deposition", "kind_label": "PDB deposition", "date": "2026-03-11", "sort_date": "2026-03-11", "year": 2026, "title": "Cryo-EM structure of the CUL1-RBX1-SKP1-FBXO22 SCF ubiquition ligase in complex with NSD2 via UNC10088", "url": "https://www.rcsb.org/structure/29HG", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "29HG", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-026-72235-9", "title": "Structural basis of NSD2 degradation via targeted recruitment of SCF-FBXO22.", "url": "https://doi.org/10.1038/s41467-026-72235-9", "doi": "10.1038/s41467-026-72235-9", "pmid": 42026065, "year": 2026 }, { "id": "DOI:10.1107/s2059798319011471", "title": "Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix", "url": "https://doi.org/10.1107/S2059798319011471", "doi": "10.1107/S2059798319011471", "pmid": 31588918, "year": 2019 } ], "date_precision": "day", "source_date": "2026-03-11T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:29HH:deposition", "id": "29HH", "kind": "deposition", "kind_label": "PDB deposition", "date": "2026-03-11", "sort_date": "2026-03-11", "year": 2026, "title": "Cryo-EM structure of the CUL1-RBX1-SKP1-FBXO22 SCF ubiquition ligase in complex with NSD2, UNC10088 and Bach1", "url": "https://www.rcsb.org/structure/29HH", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "29HH", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-026-72235-9", "title": "Structural basis of NSD2 degradation via targeted recruitment of SCF-FBXO22.", "url": "https://doi.org/10.1038/s41467-026-72235-9", "doi": "10.1038/s41467-026-72235-9", "pmid": 42026065, "year": 2026 }, { "id": "DOI:10.1107/s2059798319011471", "title": "Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix", "url": "https://doi.org/10.1107/S2059798319011471", "doi": "10.1107/S2059798319011471", "pmid": 31588918, "year": 2019 } ], "date_precision": "day", "source_date": "2026-03-11T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:29HI:deposition", "id": "29HI", "kind": "deposition", "kind_label": "PDB deposition", "date": "2026-03-11", "sort_date": "2026-03-11", "year": 2026, "title": "Cryo-EM structure of the CUL1-RBX1-SKP1-FBXO22 SCF ubiquition ligase in complex with NSD2 via UNC10415667", "url": "https://www.rcsb.org/structure/29HI", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "29HI", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-026-72235-9", "title": "Structural basis of NSD2 degradation via targeted recruitment of SCF-FBXO22.", "url": "https://doi.org/10.1038/s41467-026-72235-9", "doi": "10.1038/s41467-026-72235-9", "pmid": 42026065, "year": 2026 }, { "id": "DOI:10.1107/s2059798319011471", "title": "Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix", "url": "https://doi.org/10.1107/S2059798319011471", "doi": "10.1107/S2059798319011471", "pmid": 31588918, "year": 2019 } ], "date_precision": "day", "source_date": "2026-03-11T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9XYC:release", "id": "9XYC", "kind": "release", "kind_label": "PDB initial release", "date": "2026-03-18", "sort_date": "2026-03-18", "year": 2026, "title": "Pol II-DSIF-SPT6-PAF1c-TFIIS-IWS1-ELOF1-LEDGF-nucleosome LEDGF+nucleosome map Q", "url": "https://www.rcsb.org/structure/9XYC", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9XYC", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1093/nar/gkag357", "title": "Structure and function of IWS1 in transcription elongation.", "url": "https://doi.org/10.1093/nar/gkag357", "doi": "10.1093/nar/gkag357", "pmid": 42134803, "year": 2026 } ], "date_precision": "day", "source_date": "2026-03-18T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:29HG:release", "id": "29HG", "kind": "release", "kind_label": "PDB initial release", "date": "2026-05-06", "sort_date": "2026-05-06", "year": 2026, "title": "Cryo-EM structure of the CUL1-RBX1-SKP1-FBXO22 SCF ubiquition ligase in complex with NSD2 via UNC10088", "url": "https://www.rcsb.org/structure/29HG", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "29HG", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-026-72235-9", "title": "Structural basis of NSD2 degradation via targeted recruitment of SCF-FBXO22.", "url": "https://doi.org/10.1038/s41467-026-72235-9", "doi": "10.1038/s41467-026-72235-9", "pmid": 42026065, "year": 2026 }, { "id": "DOI:10.1107/s2059798319011471", "title": "Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix", "url": "https://doi.org/10.1107/S2059798319011471", "doi": "10.1107/S2059798319011471", "pmid": 31588918, "year": 2019 } ], "date_precision": "day", "source_date": "2026-05-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:29HH:release", "id": "29HH", "kind": "release", "kind_label": "PDB initial release", "date": "2026-05-06", "sort_date": "2026-05-06", "year": 2026, "title": "Cryo-EM structure of the CUL1-RBX1-SKP1-FBXO22 SCF ubiquition ligase in complex with NSD2, UNC10088 and Bach1", "url": "https://www.rcsb.org/structure/29HH", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "29HH", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-026-72235-9", "title": "Structural basis of NSD2 degradation via targeted recruitment of SCF-FBXO22.", "url": "https://doi.org/10.1038/s41467-026-72235-9", "doi": "10.1038/s41467-026-72235-9", "pmid": 42026065, "year": 2026 }, { "id": "DOI:10.1107/s2059798319011471", "title": "Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix", "url": "https://doi.org/10.1107/S2059798319011471", "doi": "10.1107/S2059798319011471", "pmid": 31588918, "year": 2019 } ], "date_precision": "day", "source_date": "2026-05-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:29HI:release", "id": "29HI", "kind": "release", "kind_label": "PDB initial release", "date": "2026-05-06", "sort_date": "2026-05-06", "year": 2026, "title": "Cryo-EM structure of the CUL1-RBX1-SKP1-FBXO22 SCF ubiquition ligase in complex with NSD2 via UNC10415667", "url": "https://www.rcsb.org/structure/29HI", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "29HI", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-026-72235-9", "title": "Structural basis of NSD2 degradation via targeted recruitment of SCF-FBXO22.", "url": "https://doi.org/10.1038/s41467-026-72235-9", "doi": "10.1038/s41467-026-72235-9", "pmid": 42026065, "year": 2026 }, { "id": "DOI:10.1107/s2059798319011471", "title": "Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix", "url": "https://doi.org/10.1107/S2059798319011471", "doi": "10.1107/S2059798319011471", "pmid": 31588918, "year": 2019 } ], "date_precision": "day", "source_date": "2026-05-06T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9Y60:release", "id": "9Y60", "kind": "release", "kind_label": "PDB initial release", "date": "2026-07-15", "sort_date": "2026-07-15", "year": 2026, "title": "Crystal structure of NSD2 PWWP1 domain in complex with (6R)-6-(3,5-dichlorophenyl)morpholin-3-one (ligand 2)", "url": "https://www.rcsb.org/structure/9Y60", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9Y60", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1182/blood.2025031998", "title": "NSD2 degradation remediates the oncogenic cistrome in t(4;14) multiple myeloma.", "url": "https://doi.org/10.1182/blood.2025031998", "doi": "10.1182/blood.2025031998", "pmid": 42371798, "year": 2026 } ], "date_precision": "day", "source_date": "2026-07-15T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9Y61:release", "id": "9Y61", "kind": "release", "kind_label": "PDB initial release", "date": "2026-07-15", "sort_date": "2026-07-15", "year": 2026, "title": "Cryo-EM structure of ternary complex NSD2-PWWP1:CRBN:DDB1 in complex with NSD2-LDD, an LDD degrader", "url": "https://www.rcsb.org/structure/9Y61", "proteins": [ { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9Y61", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O96028:PWWP1", "gene": "NSD2", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1182/blood.2025031998", "title": "NSD2 degradation remediates the oncogenic cistrome in t(4;14) multiple myeloma.", "url": "https://doi.org/10.1182/blood.2025031998", "doi": "10.1182/blood.2025031998", "pmid": 42371798, "year": 2026 } ], "date_precision": "day", "source_date": "2026-07-15T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9S29:release", "id": "9S29", "kind": "release", "kind_label": "PDB initial release", "date": "2026-07-29", "sort_date": "2026-07-29", "year": 2026, "title": "MVV CSC intasome in complex with LEDGF", "url": "https://www.rcsb.org/structure/9S29", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9S29", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-026-76698-8", "title": "Core nucleosomes are refractory to lentiviral DNA integration.", "url": "https://doi.org/10.1038/s41467-026-76698-8", "doi": "10.1038/s41467-026-76698-8", "pmid": 42749731, "year": 2026 } ], "date_precision": "day", "source_date": "2026-07-29T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:9S28:release", "id": "9S28", "kind": "release", "kind_label": "PDB initial release", "date": "2026-08-05", "sort_date": "2026-08-05", "year": 2026, "title": "MVV STC intasome in complex with LEDGF", "url": "https://www.rcsb.org/structure/9S28", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9S28", "in_atlas": true, "observed_pwwp": false } ], "domains": [], "ligands": [], "references": [ { "id": "DOI:10.1038/s41467-026-76698-8", "title": "Core nucleosomes are refractory to lentiviral DNA integration.", "url": "https://doi.org/10.1038/s41467-026-76698-8", "doi": "10.1038/s41467-026-76698-8", "pmid": 42749731, "year": 2026 } ], "date_precision": "day", "source_date": "2026-08-05T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "PWWP-associated entry; inspect mapped coordinate coverage", "observed_pwwp": false }, { "event_id": "PDB:9S81:release", "id": "9S81", "kind": "release", "kind_label": "PDB initial release", "date": "2026-08-05", "sort_date": "2026-08-05", "year": 2026, "title": "Crystal structure of the LEDGF PWWP domain", "url": "https://www.rcsb.org/structure/9S81", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9S81", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1002/pro.70726", "title": "De novo design of proteinaceous binders targeting the LEDGF PWWP domain.", "url": "https://doi.org/10.1002/pro.70726", "doi": "10.1002/pro.70726", "pmid": 42489162, "year": 2026 } ], "date_precision": "day", "source_date": "2026-08-05T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:9S83:release", "id": "9S83", "kind": "release", "kind_label": "PDB initial release", "date": "2026-08-05", "sort_date": "2026-08-05", "year": 2026, "title": "Crystal structure of de novo designed binder JUBO4 and the LEDGF PWWP domain", "url": "https://www.rcsb.org/structure/9S83", "proteins": [ { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "9S83", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:O75475:PWWP1", "gene": "PSIP1", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1002/pro.70726", "title": "De novo design of proteinaceous binders targeting the LEDGF PWWP domain.", "url": "https://doi.org/10.1002/pro.70726", "doi": "10.1002/pro.70726", "pmid": 42489162, "year": 2026 } ], "date_precision": "day", "source_date": "2026-08-05T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:11NZ:release", "id": "11NZ", "kind": "release", "kind_label": "PDB initial release", "date": "2026-08-19", "sort_date": "2026-08-19", "year": 2026, "title": "Cryo-EM structure of human DNMT3A R882H decamer", "url": "https://www.rcsb.org/structure/11NZ", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "11NZ", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1073/pnas.2609226123", "title": "Multidomain interaction governs the filamentous assembly of the dominant-negative DNMT3A R882H mutant.", "url": "https://doi.org/10.1073/pnas.2609226123", "doi": "10.1073/pnas.2609226123", "pmid": 42640801, "year": 2026 } ], "date_precision": "day", "source_date": "2026-08-19T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:11OA:release", "id": "11OA", "kind": "release", "kind_label": "PDB initial release", "date": "2026-08-19", "sort_date": "2026-08-19", "year": 2026, "title": "Cryo-EM structure of human DNMT3A R882H octadecamer", "url": "https://www.rcsb.org/structure/11OA", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "11OA", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1073/pnas.2609226123", "title": "Multidomain interaction governs the filamentous assembly of the dominant-negative DNMT3A R882H mutant.", "url": "https://doi.org/10.1073/pnas.2609226123", "doi": "10.1073/pnas.2609226123", "pmid": 42640801, "year": 2026 } ], "date_precision": "day", "source_date": "2026-08-19T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:11OH:release", "id": "11OH", "kind": "release", "kind_label": "PDB initial release", "date": "2026-08-19", "sort_date": "2026-08-19", "year": 2026, "title": "Cryo-EM structure of human DNMT3A homo-tetramer", "url": "https://www.rcsb.org/structure/11OH", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "11OH", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1073/pnas.2609226123", "title": "Multidomain interaction governs the filamentous assembly of the dominant-negative DNMT3A R882H mutant.", "url": "https://doi.org/10.1073/pnas.2609226123", "doi": "10.1073/pnas.2609226123", "pmid": 42640801, "year": 2026 } ], "date_precision": "day", "source_date": "2026-08-19T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true }, { "event_id": "PDB:11OI:release", "id": "11OI", "kind": "release", "kind_label": "PDB initial release", "date": "2026-08-19", "sort_date": "2026-08-19", "year": 2026, "title": "Cryo-EM structure of human DNMT3A homo-hexamer", "url": "https://www.rcsb.org/structure/11OI", "proteins": [ { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "structures": [ { "pdb_id": "11OI", "in_atlas": true, "observed_pwwp": true } ], "domains": [ { "domain_id": "UP:Q9Y6K1:PWWP1", "gene": "DNMT3A", "domain_name": "PWWP1" } ], "ligands": [], "references": [ { "id": "DOI:10.1073/pnas.2609226123", "title": "Multidomain interaction governs the filamentous assembly of the dominant-negative DNMT3A R882H mutant.", "url": "https://doi.org/10.1073/pnas.2609226123", "doi": "10.1073/pnas.2609226123", "pmid": 42640801, "year": 2026 } ], "date_precision": "day", "source_date": "2026-08-19T00:00:00.000+00:00", "date_note": "PDB deposition and initial release are separate metadata events; neither establishes publication date or historical priority.", "verification_level": "Frozen experimental deposition metadata with Atlas domain-coordinate mapping", "relevance": "Observed PWWP coordinates in this entry", "observed_pwwp": true } ], "proteins": [ { "protein_id": "UP:A0A494C071", "uniprot": "A0A494C071", "gene": "PWWP4", "organism": "Homo sapiens" }, { "protein_id": "UP:O59676", "uniprot": "O59676", "gene": "pdp1", "organism": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)" }, { "protein_id": "UP:O75475", "uniprot": "O75475", "gene": "PSIP1", "organism": "Homo sapiens" }, { "protein_id": "UP:O88509", "uniprot": "O88509", "gene": "Dnmt3b", "organism": "Mus musculus" }, { "protein_id": "UP:O94312", "uniprot": "O94312", "gene": "pdp2", "organism": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)" }, { "protein_id": "UP:O95696", "uniprot": "O95696", "gene": "BRD1", "organism": "Homo sapiens" }, { "protein_id": "UP:O96028", "uniprot": "O96028", "gene": "NSD2", "organism": "Homo sapiens" }, { "protein_id": "UP:P29374", "uniprot": "P29374", "gene": "ARID4A", "organism": "Homo sapiens" }, { "protein_id": "UP:P51858", "uniprot": "P51858", "gene": "HDGF", "organism": "Homo sapiens" }, { "protein_id": "UP:P52701", "uniprot": "P52701", "gene": "MSH6", "organism": "Homo sapiens" }, { "protein_id": "UP:P55201", "uniprot": "P55201", "gene": "BRPF1", "organism": "Homo sapiens" }, { "protein_id": "UP:Q04213", "uniprot": "Q04213", "gene": "IOC4", "organism": "Saccharomyces cerevisiae (strain ATCC 204508 / S288c)" }, { "protein_id": "UP:Q15326", "uniprot": "Q15326", "gene": "ZMYND11", "organism": "Homo sapiens" }, { "protein_id": "UP:Q15652", "uniprot": "Q15652", "gene": "JMJD1C", "organism": "Homo sapiens" }, { "protein_id": "UP:Q2TAK8", "uniprot": "Q2TAK8", "gene": "PWWP3A", "organism": "Homo sapiens" }, { "protein_id": "UP:Q49A26", "uniprot": "Q49A26", "gene": "GLYR1", "organism": "Homo sapiens" }, { "protein_id": "UP:Q4LE39", "uniprot": "Q4LE39", "gene": "ARID4B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q504Y3", "uniprot": "Q504Y3", "gene": "ZCWPW2", "organism": "Homo sapiens" }, { "protein_id": "UP:Q586Y0", "uniprot": "Q586Y0", "gene": "28H13_90", "organism": "Trypanosoma brucei brucei (strain 927/4 GUTat10.1)" }, { "protein_id": "UP:Q5H9M0", "uniprot": "Q5H9M0", "gene": "PWWP3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q5TGJ6", "uniprot": "Q5TGJ6", "gene": "HDGFL1", "organism": "Homo sapiens" }, { "protein_id": "UP:Q6NUJ5", "uniprot": "Q6NUJ5", "gene": "PWWP2B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q7LBC6", "uniprot": "Q7LBC6", "gene": "KDM3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q7Z4V5", "uniprot": "Q7Z4V5", "gene": "HDGFL2", "organism": "Homo sapiens" }, { "protein_id": "UP:Q8R5C8", "uniprot": "Q8R5C8", "gene": "Zmynd11", "organism": "Mus musculus" }, { "protein_id": "UP:Q8VHK7", "uniprot": "Q8VHK7", "gene": "Hdgf", "organism": "Rattus norvegicus" }, { "protein_id": "UP:Q96L73", "uniprot": "Q96L73", "gene": "NSD1", "organism": "Homo sapiens" }, { "protein_id": "UP:Q96N64", "uniprot": "Q96N64", "gene": "PWWP2A", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9BZ95", "uniprot": "Q9BZ95", "gene": "NSD3", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9H0M4", "uniprot": "Q9H0M4", "gene": "ZCWPW1", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9JMG7", "uniprot": "Q9JMG7", "gene": "Hdgfl3", "organism": "Mus musculus" }, { "protein_id": "UP:Q9P267", "uniprot": "Q9P267", "gene": "MBD5", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9UBC3", "uniprot": "Q9UBC3", "gene": "DNMT3B", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9ULD4", "uniprot": "Q9ULD4", "gene": "BRPF3", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9ULU4", "uniprot": "Q9ULU4", "gene": "ZMYND8", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9VAA9", "uniprot": "Q9VAA9", "gene": "Jasper", "organism": "Drosophila melanogaster" }, { "protein_id": "UP:Q9Y3E1", "uniprot": "Q9Y3E1", "gene": "HDGFL3", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y4C1", "uniprot": "Q9Y4C1", "gene": "KDM3A", "organism": "Homo sapiens" }, { "protein_id": "UP:Q9Y6K1", "uniprot": "Q9Y6K1", "gene": "DNMT3A", "organism": "Homo sapiens" } ], "feature_exclusions": [] }